Property Summary

NCBI Gene PubMed Count 41
PubMed Score 43.04
PubTator Score 34.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer 1.100 8.2e-03
cutaneous lupus erythematosus 2.300 8.8e-04
ductal carcinoma in situ 1.400 1.6e-03
gastric carcinoma 1.200 2.4e-02
head and neck cancer and chronic obstruc... 1.100 7.3e-03
interstitial cystitis 1.700 1.3e-03
lung carcinoma -1.100 1.0e-09
malignant mesothelioma -1.500 2.1e-07
mucosa-associated lymphoid tissue lympho... 1.187 1.9e-02
non diabetic and post-ischemic heart fai... -1.200 2.1e-02
oligodendroglioma -1.100 9.9e-04
osteosarcoma -2.169 3.0e-04
ovarian cancer 1.100 6.6e-03
posterior fossa group B ependymoma -1.400 7.7e-08
primary Sjogren syndrome 1.400 1.9e-03
psoriasis -2.000 2.1e-04
ulcerative colitis 1.800 1.8e-05

 CSPA Cell Line (1)

Gene RIF (26)

AA Sequence

MPGGAGAARLCLLAFALQPLRPRAAREPGWTRGSEEGSPKLQHELIIPQWKTSESPVREKHPLKAELRVM      1 - 70
AEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRETELSSVTLSTCRGIRGLIT     71 - 140
VSSNLSYVIEPLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRRMKREDLNSMK    141 - 210
YVELYLVADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLW    211 - 280
SFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHN    281 - 350
FGMTHDSADCCSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCG    351 - 420
NGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQCDLPEFCTGK    421 - 490
SPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNG    491 - 560
EHRKCNMRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGT    561 - 630
KCGYNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPESV    631 - 700
GPVVAGVLVAILVLAVLMLMYYCCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTP    701 - 770
QGKRKVINTPEILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPI    771 - 840
PPAPNCIVSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAALAPKVSPREALKV    841 - 910
KAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPA                             911 - 955
//

Text Mined References (45)

PMID Year Title