Property Summary

NCBI Gene PubMed Count 351
PubMed Score 3569.04
PubTator Score 889.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Acquired thrombocytopenia 8
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 23
Adrenogenital disorder 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 22
Allergic rhinitis 93
Angioedema 33
Ankylosing spondylitis 134
Articular gout 11
Aspiration pneumonitis 6
Asthma 370
Atopic dermatitis 915
Autoimmune disease 5
Autoimmune hemolytic anemia 30
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 26
Blepharoconjunctivitis 5
Bursitis 10
Cerebral Edema 30
Congenital adrenal hyperplasia 71
Congenital hypoplastic anemia 8
Contact Dermatitis 77
Corneal Ulcer 20
Corneal abrasion 5
Crohn's disease 311
Cyclitis 5
Dacryocystitis 11
Dermatitis herpetiformis 12
Diagnostic Test for Cushing's Syndrome 5
Discoid lupus erythematosus 7
Disorder of eye 26
Disorder of musculoskeletal system 5
Disorder of skin 5
Edema of larynx 5
Eosinophilic asthma 6
Epicondylitis 22
Eruption of skin 5
Erythema multiforme 16
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Extrinsic allergic alveolitis 5
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 7
Granuloma annulare 5
Herpes zoster keratitis 5
Hodgkin's disease 18
Humoral hypercalcemia of malignancy 6
Idiopathic thrombocytopenic purpura 5
Infective blepharitis 5
Inflammatory bowel disease 148
Iridocyclitis 19
Iritis 8
Juvenile rheumatoid arthritis 110
Keratitis 60
Lichen simplex chronicus 7
Löffler's syndrome 5
Meibomianitis 4
Miliary tuberculosis 6
Multiple Sclerosis 527
Mycosis fungoides 29
Nephrotic Syndrome 76
Non-Hodgkin's lymphoma 22
Ocular rosacea 4
Pemphigus 23
Plaque psoriasis 17
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 9
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Progressive Diffuse Large B-Cell Lymphoma 4
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Punctate keratopathy 5
Rheumatic heart disease 10
Rheumatoid arthritis 1156
Rosacea 23
Scalp psoriasis 6
Seborrheic dermatitis 31
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Stevens-Johnson syndrome 92
Superficial Ocular Infection 5
Sympathetic uveitis 4
Synovitis 75
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Systemic lupus erythematosus 191
Tendinitis 14
Tenosynovitis 14
Thyroiditis 28
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Uveitis 102
psoriasis 6514
sarcoidosis 357
ulcerative colitis 1765
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Kidney cancer 2548 0.0 0.5

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.4e-04
atypical teratoid/rhabdoid tumor 1.200 8.5e-04
diabetes mellitus -1.100 1.4e-02
ependymoma 1.300 7.4e-06
glioblastoma 1.400 4.6e-05
group 3 medulloblastoma 1.200 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.100 2.0e-02
lung cancer -1.200 1.3e-02
lung carcinoma -1.500 1.0e-21
osteosarcoma 2.357 4.0e-06
ovarian cancer 2.900 3.3e-08
pediatric high grade glioma 1.200 1.6e-03
primitive neuroectodermal tumor 1.100 5.0e-04
subependymal giant cell astrocytoma 1.201 2.8e-02

Protein-protein Interaction (2)

Gene RIF (326)

AA Sequence

MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLL      1 - 70
TFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRI     71 - 140
NTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVH    141 - 210
RVKRRADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIE    211 - 280
QIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGL    281 - 350
AYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL    351 - 420
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGNSRVDEGEECD    421 - 490
PGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGN    491 - 560
AEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPC    561 - 630
TVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDK    631 - 700
QYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDS    701 - 770
HMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC                    771 - 824
//

Text Mined References (357)

PMID Year Title