Property Summary

NCBI Gene PubMed Count 70
PubMed Score 84.09
PubTator Score 78.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.049 1.5
Adhesions of uterus 4 3.013 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.100 6.1e-03
non-inflammatory breast cancer 1.100 1.1e-02
osteosarcoma 1.513 6.7e-06

Gene

PANTHER Protein Class (3)

Gene RIF (53)

AA Sequence

MRLALLWALGLLGAGSPLPSWPLPNIGGTEEQQAESEKAPREPLEPQVLQDDLPISLKKVLQTSLPEPLR      1 - 70
IKLELDGDSHILELLQNRELVPGRPTLVWYQPDGTRVVSEGHTLENCCYQGRVRGYAGSWVSICTCSGLR     71 - 140
GLVVLTPERSYTLEQGPGDLQGPPIISRIQDLHLPGHTCALSWRESVHTQKPPEHPLGQRHIRRRRDVVT    141 - 210
ETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVT    211 - 280
LENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHEL    281 - 350
GHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPM    351 - 420
AAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLP    421 - 490
EFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSC    491 - 560
GRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTL    561 - 630
PGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTTGLLL    631 - 700
SLLVLLVLVMLGASYWYRARLHQRLCQLKGPTCQYRAAQSGPSERPGPPQRALLARGTKQASALSFPAPP    701 - 770
SRPLPPDPVSKRLQAELADRPNPPTRPLPADPVVRSPKSQGPAKPPPPRKPLPADPQGRCPSGDLPGPGA    771 - 840
GIPPLVVPSRPAPPPPTVSSLYL                                                   841 - 863
//

Text Mined References (73)

PMID Year Title