Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.59
PubTator Score 19.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 3.1e-03
ependymoma -2.300 4.3e-15
osteosarcoma 1.075 8.9e-04
glioblastoma -2.600 2.6e-07
medulloblastoma -1.800 2.3e-05
atypical teratoid / rhabdoid tumor -2.300 2.1e-10
medulloblastoma, large-cell -1.800 2.4e-04
primitive neuroectodermal tumor -1.800 1.9e-04
pediatric high grade glioma -2.400 4.5e-10
pilocytic astrocytoma -2.600 7.8e-13
ovarian cancer -1.100 7.7e-06

Gene RIF (1)

PMID Text
11545539 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLLRRWAFAALLLSLLPTPGLGTQGPAGALRWGGLPQLGGPGAPEVTEPSRLVRESSGGEVRKQQLDTR      1 - 70
VRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSREGTTQHSTGAGDHCYYQGKLR     71 - 140
GNPHSFAALSTCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLPDPLGCREPGCLFAVP    141 - 210
AQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQ    211 - 280
LNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICS    281 - 350
LSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSID    351 - 420
EYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLC    421 - 490
CRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGH    491 - 560
AAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLVGDISSVTFYHQGKE    561 - 630
LDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCIC    631 - 700
QPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA     701 - 769
//

Text Mined References (13)

PMID Year Title
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14759258 2004 An unappreciated role for RNA surveillance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11545539 2001 ADH2 and alcohol-related phenotypes in Ashkenazic Jewish American college students.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9693107 1998 Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8252040 1993 A novel metalloprotease/disintegrin-like gene at 17q21.3 is somatically rearranged in two primary breast cancers.
7956356 1995 Human metalloprotease/disintegrin-like (MDC) gene: exon-intron organization and alternative splicing.
7593158 1995 ADAM, a novel family of membrane proteins containing A Disintegrin And Metalloprotease domain: multipotential functions in cell-cell and cell-matrix interactions.