Property Summary

NCBI Gene PubMed Count 4
PubMed Score 22.25
PubTator Score 6.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma 720 8.4e-06
medulloblastoma, large-cell 6241 5.0e-04
glioblastoma 5792 6.3e-04
Disease Target Count Z-score Confidence
Spastic hemiplegia 7 4.364 2.2
Epididymitis 8 3.637 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 6.3e-04
medulloblastoma -1.200 8.4e-06
medulloblastoma, large-cell -1.300 5.0e-04

Gene RIF (2)

AA Sequence

MIEAEEQQPCKTDFYSELPKVELHAHLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMF      1 - 70
QTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDID     71 - 140
VRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLS    141 - 210
EIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLELCLTSNVKSQTVPSYDQHHFGF    211 - 280
WYSIAHPSVICTDDKGVFATHLSQEYQLAAETFNLTQSQVWDLSYESINYIFASDSTRSELRKKWNHLKP    281 - 350
RVLHI                                                                     351 - 355
//

Text Mined References (7)

PMID Year Title