Property Summary

NCBI Gene PubMed Count 17
PubMed Score 22.80
PubTator Score 5.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (8)

PMID Text
20553587 The KIAA1109-TENR-IL2-IL21 gene cluster, that encodes an interleukin (IL-21) that plays an important role in Th17 cell biology, is the 20th locus for which there is a genome-wide level of support for association with rheumatoid arthritis.
20553587 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19523143 Observational study of gene-disease association. (HuGE Navigator)
19302705 Using a family-based study, we have provided a trend for the association of the KIAA1109/Tenr/IL2/IL21 gene region with rheumatoid arthritis in populations of European descent
19302705 Observational study of gene-disease association. (HuGE Navigator)
17558408 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17558408 Genetic variation in a linkage disequilibrium block encompassing the KIAA1109-TENR-IL2-IL21 genes predisposes to celiac disease.

AA Sequence

MASNNHWFQSSQVPSFAQMLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLS      1 - 70
SISNPVLPPKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQYK     71 - 140
TGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVHYEGRHIQYAKIS    141 - 210
QIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYSQDIKPDGRVLHDTHAVVTARRS    211 - 280
LLRYFYRQLLLFYSKNPAMMEKSIFCTEPTSNLLTLKQNINICLYMNQLPKGSAQIKSQLRLNPHSISAF    281 - 350
EANEELCLHVAVEGKIYLTVYCPKDGVNRISSMSSSDKLTRWEVLGVQGALLSHFIQPVYISSILIGDGN    351 - 420
CSDTRGLEIAIKQRVDDALTSKLPMFYLVNRPHISLVPSAYPLQMNLEYKFLSLNWAQGDVSLEIVDGLS    421 - 490
GKITESSPFKSGMSMASRLCKAAMLSRFNLLAKEAKKELLEAGTYHAAKCMSASYQEAKCKLKSYLQQHG    491 - 560
YGSWIVKSPCIEQFNM                                                          561 - 576
//

Text Mined References (19)

PMID Year Title
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20553587 2010 Only one independent genetic association with rheumatoid arthritis within the KIAA1109-TENR-IL2-IL21 locus in Caucasian sample sets: confirmation of association of rs6822844 with rheumatoid arthritis at a genome-wide level of significance.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
19523143 2009 Multiple sclerosis association study with the TENR-IL2-IL21 region in a Spanish population.
19302705 2009 Testing for the association of the KIAA1109/Tenr/IL2/IL21 gene region with rheumatoid arthritis in a European family-based study.
18311140 2008 Newly identified genetic risk variants for celiac disease related to the immune response.
17558408 2007 A genome-wide association study for celiac disease identifies risk variants in the region harboring IL2 and IL21.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9541871 1998 Statistical modelling and phylogenetic analysis of a deaminase domain.
7543294 1995 Distribution of Tenr, an RNA-binding protein, in a lattice-like network within the spermatid nucleus in the mouse.