Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.15
PubTator Score 3.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 3.3e-04
aldosterone-producing adenoma -1.068 2.6e-02
astrocytic glioma -1.300 1.6e-02
Astrocytoma, Pilocytic -1.300 1.1e-04
glioblastoma -1.300 3.8e-03
intraductal papillary-mucinous adenoma (... 1.200 4.1e-03
intraductal papillary-mucinous carcinoma... 1.700 1.3e-03
intraductal papillary-mucinous neoplasm ... 2.000 5.5e-03
lung cancer 1.300 7.6e-03
osteosarcoma -1.758 6.5e-04
ovarian cancer 1.300 2.0e-02
Pick disease -1.300 1.2e-04

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (2)

AA Sequence

MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG      1 - 70
SPKSHIDKANFNNEKVILKLDYSDFQIVK                                              71 - 99
//

Text Mined References (15)

PMID Year Title