Property Summary

NCBI Gene PubMed Count 43
PubMed Score 99.68
PubTator Score 147.94

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (12)

PMID Text
24846301 ACY1 acts as a tumor suppressor in hepatocellular carcinoma.
24117009 Biochemical analysis showed absence of ACY1 enzyme activity in the patient's fibroblasts.
23739232 Report serum aminoacylase-1 as a novel biomarker with potential prognostic utility for long-term outcome in renal transplant recipients with delayed graft function.
23317546 We concluded that ACY1 expression in colorectal cancer varies with stage and appears to play a role in cell proliferation and apoptosis
21414403 aminoacylase 1 proteins with the mutations p.Arg378Trp, p.Arg378Gln and p.Arg393His were also detected in Western blot analysis
21128244 These data suggest that aminoacylase expression is dysregulated in neuroblastoma.
20480396 Case Report: ACY1-deficient patient presenting with autistic features.
18341290 T347S variant of human Acy1 exhibited markedly increased catalytic efficiency against N-benzoylamino acids
17045186 Because hK1 amidase activity is significantly lower in urine of systolic HF patients, it can be supposed that activity of renal kallikrein-kinin system may be suppressed in this systolic heart failure.
16465618 Genetic deficiency of ACY1 leads to functional ACY1 deficiency and excretion of N-acetylated amino acids.
16274666 first report of a patient with aminoacylase I deficiency
12933810 by complementing different active site mutants of human aminoacylase-1, study shows that catalysis occurs at the dimer interface

AA Sequence

MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNP      1 - 70
TLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIH     71 - 140
MTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRF    141 - 210
MEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPD    211 - 280
VDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNR    281 - 350
YIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS                351 - 408
//

Text Mined References (48)

PMID Year Title
24846301 2014 Proteomics-based identification of the tumor suppressor role of aminoacylase 1 in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24117009 2014 Aminoacylase I deficiency due to ACY1 mRNA exon skipping.
23739232 2013 Serum aminoacylase-1 is a novel biomarker with potential prognostic utility for long-term outcome in patients with delayed graft function following renal transplantation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23317546 2013 Overexpression of aminoacylase 1 is associated with colorectal cancer progression.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21414403 2011 The molecular basis of aminoacylase 1 deficiency.
21269460 2011 Initial characterization of the human central proteome.
21128244 2011 Differential aminoacylase expression in neuroblastoma.
21082674 2010 Comprehensive analysis of low-abundance proteins in human urinary exosomes using peptide ligand library technology, peptide OFFGEL fractionation and nanoHPLC-chip-MS/MS.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18341290 2008 Probing the acyl-binding pocket of aminoacylase-1.
17562838 2007 Neurological findings in aminoacylase 1 deficiency.
17516490 2008 NMR spectroscopy of aminoacylase 1 deficiency, a novel inborn error of metabolism.
17045186 2006 The amidase activity of human tissue kallikrein is significantly lower in the urine of patients with systolic heart failure.
16962797 2006 Protein profiling and transcript expression levels of heat shock proteins in 17beta-estradiol-treated human MCF-7 breast cancer cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16889417 2006 Comparative proteomics in neurodegenerative and non-neurodegenerative diseases suggest nodal point proteins in regulatory networking.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16465618 2006 Mutations in ACY1, the gene encoding aminoacylase 1, cause a novel inborn error of metabolism.
16404153 2005 Mitogenic estrogen metabolites alter the expression of 17beta-estradiol-regulated proteins including heat shock proteins in human MCF-7 breast cancer cells.
16313167 2005 Roles of dimerization domain residues in binding and catalysis by aminoacylase-1.
16274666 2005 Aminoacylase I deficiency: a novel inborn error of metabolism.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15953868 2005 Identification of proteins differentially expressed in the conventional renal cell carcinoma by proteomic analysis.
15927344 2005 Catabolism of intracellular N-terminal acetylated proteins: involvement of acylpeptide hydrolase and acylase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
12933810 2003 Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
12548635 2003 Proteome analysis on an early transformed human bronchial epithelial cell line, BEP2D, after alpha-particle irradiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11250542 2001 Sequence analysis of the aminoacylase-1 family. A new proposed signature for metalloexopeptidases.
11154063 2000 Mutational analysis of two PWW sequence motifs in human aminoacylase 1.
8394326 1993 Human aminoacylase-1. Cloning, sequence, and expression analysis of a chromosome 3p21 gene inactivated in small cell lung cancer.
8357837 1993 The nucleotide sequence of human aminoacylase-1.
7974002 1994 Isolation of two contigs of overlapping cosmids derived from human chromosomal band 3p21.1 and identification of 5 new 3p21.1 genes.
6948533 1980 Confirmation and further regional assignment of aminoacylase 1 (acy-1) on human chromosome 3 using a simplified detection method.
6803586 1982 Mapping of aminoacylase-1 and beta-galactosidase-A to homologous regions of human chromosome 3 and mouse chromosome 9 suggests location of additional genes.
6781469 1980 Electrophoretic patterns of aminoacylase-1 (ACY-1) isozymes in vertebrate cells and histochemical procedure for detecting ACY-1 activity.
6248297 1980 Integration site(s) of herpes simplex virus type 1 thymidine kinase gene and regional assignment of the gene for aminoacylase-1 in human chromosomes.
2745715 1989 Monoclonal antibody based immunoassay for human aminoacylase-1.
2542383 1989 Lack of expression of aminoacylase-1 in small cell lung cancer. Evidence for inactivation of genes encoded by chromosome 3p.
1707030 1990 Human aminoacylase-1: cloning, regional assignment to distal chromosome 3p21.1, and identification of a cross-hybridizing sequence on chromosome 18.
373141 1979 Bioautographic visualization of aminoacylase-1: assignment of the structural gene ACY-1 to chromosome 3 in man.