Property Summary

NCBI Gene PubMed Count 57
PubMed Score 122.91
PubTator Score 60.18

Knowledge Summary

Patent (65,695)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 6.1e-03
group 3 medulloblastoma 1.700 6.3e-05
interstitial cystitis -1.400 3.2e-03
lung cancer 2.900 3.0e-06
malignant mesothelioma 1.400 7.9e-05
medulloblastoma, large-cell 1.300 2.0e-05
osteosarcoma 1.275 1.4e-04
Pick disease 1.200 1.4e-06
primitive neuroectodermal tumor 1.200 3.9e-02
subependymal giant cell astrocytoma -1.334 4.2e-02

 CSPA Cell Line (1)

Gene RIF (22)

AA Sequence

MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTI      1 - 70
ELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLA     71 - 140
YSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLM    141 - 210
NDFVAVKIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGN    211 - 280
IITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGK    281 - 350
PPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ    351 - 420
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSLIRRSVNGTTS    421 - 490
DCLVSLVTSVTNVDLPPKESSI                                                    491 - 512
//

Text Mined References (60)

PMID Year Title