Property Summary

NCBI Gene PubMed Count 103
PubMed Score 253.49
PubTator Score 178.93

Knowledge Summary

Patent (22,078)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.200 2.6e-03
osteosarcoma 3.074 3.3e-07
fascioscapulohumeral muscular dystrophy 1.032 6.2e-04
acute quadriplegic myopathy 1.022 2.4e-04
group 4 medulloblastoma 1.800 8.8e-04
ulcerative colitis 1.500 3.8e-08
ovarian cancer 2.200 4.1e-04

Protein-protein Interaction (8)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (72)

PMID Text
26776312 Common mutations in ALK2/ACVR1, a multi-faceted receptor, have roles in distinct pediatric musculoskeletal and neural orphan disorders.
26621707 Fibrodysplasia ossificans progressiva-ACVR1 abnormally transduces bone morphogenetic protein signaling in response to Activin-A.
26597752 The higher PE activin A concentrations resulted in abnormal endothelial functions, which may contribute to the systemic maternal vascular endothelial cell dysfunction observed in the disorder.
26133550 Changes in the binding site residue(e.g. pre-hinge region in ALK2) or side chain orientation (e.g. Tyr219 in caALK2 vs. wtALK2), or ligand modification (e.g. DMH1 vs. LDN193189) causes distinct binding profiles and selectivity among BMP inhibitors.
26097044 A report of two patients has been presented with multi-system involvement in a severe variant of fibrodysplasia ossificans progressiva caused by the ACVR1 c.772G>A; R258G mutation.
26058333 Genetic analysis of ACVR1 identified the recurrent allelic variant c.617 G>A; p.R206H in 12 of 14 Fibrodysplasia Ossificans Progressiva (FOP)patients. One of the remaining patients had a previously reported allele c.1067G>A; p.G356D in the 9th exon and the second allele c.983G>A; p.G328E in the 8th exon of ACVR1.
25271001 clinically aggressive stem cell-like subtype of hepatocellular carcinoma characterized by miR-148a-ACVR1-BMP-Wnt circuit
25101911 compounds demonstrated consistent binding to a panel of mutant and wild-type ALK2 proteins
24798338 ALK2 (R206H) mutation increases osteoclast formation through TGF-beta. The activation of activin-like kinase signaling enhanced osteoclast formation through TGF-beta expression during heterotopic ossification in muscle tissues.
24705254 ACVR1 mutations in diffuse intrinsic pontine gliomas were constitutively activating, leading to SMAD phosphorylation and increased expression of the downstream activin signaling targets ID1 and ID2.
24705252 Recurrent activating ACVR1 mutations in diffuse intrinsic pontine glioma.
24705251 Recurrent somatic mutations in ACVR1 found in diffuse intrinsic pontine gliomas.
24705250 Recurrent somatic mutations in ACVR1 in pediatric midline high-grade astrocytoma.
24347165 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-beta signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24162774 HIV-1 gp120 upregulates the expression of activin A receptor, type I (ACVR1) in human B cells
24047559 The findings provide novel insights into the molecular mechanisms that regulate expression of the ACVR1 gene and that could be targets of new strategies for future therapeutic treatments.
23918320 heterozygous mutation i.e., c.617(G>A)in ACVR1 was detected in patients with rare genetic disorder - Fibrodysplasia ossificans progressiva
23260810 Disease causing mutations in the ACVR1 gene identified in Turkish patients diagnosed as fibrodysplasia ossificans progressiva.
23227223 Functional analysis of the 3'UTR region by Luciferase reporter assays showed that it plays an inhibitory role on ACVR1/Alk-2 gene expression.
23169291 Study suggests that activin A contributes to the malignant phenotype of malignant pleural mesothelioma (MPM) cells via regulation of cyclin D and may represent a valuable candidate for therapeutic interference.
23142694 ALK2 may be an important receptor in ET-1 production during BMPR2 knockdown
22977237 The crystal structure of the cytoplasmic domain of ALK2 in complex with the inhibitors FKBP12 and dorsomorphin.
22971142 Presence of the 455C allele of BMP4 and the 8474T allele of ACVR1 gene was significantly associated with decreased left ventricular ejection fraction (LVEF) (p=0.0004 and p=0.046, respectively).
22949078 Constitutive activation of ALK2 such as that caused by the Fibrodysplasia Ossificans Progressiva mutation inhibits the generation and maintenance of human induced pluripotent stem cells.
22884369 Luminal iron levels govern intestinal tumorigenesis after Apc loss in vivo.
22748444 Confirmation of the presence of this recurrent mutation facilitates diagnostic accuracy in affected persons in South Africa, and allows researchers to narrow the search for molecular targets for rational intervention to the ACVR1/ALK2 domain.
22630080 Fibrodysplasia ossificans progressiva has been linked to an autosomal dominant mutation on chromosome 2, to the gene encoding activin receptor-like kinase 2 (ALK2), a BMP type I receptor
22408438 miR-148a is an important mediator of ACVR1, thus offering a new potential target for the development of therapeutic agents against Fibrodysplasia ossificans progressiva.
21878751 miR-30c expression was increased during adipogenesis of multipotent adipose-derived stem cells; miRNA target prediction revealed 2 putative direct targets of miR-30c, PAI-1 and ALK2, both inversely regulated to miR-30c during adipogenesis and responsive to miR-30c overexpression
21668474 copy number alterations at 2q24 can be involved in ACVR1 overexpression, which is associated with longer overall survival in laryngeal carcinomas
21617230 Low activin A in the cytosol is associated with upper urinary tract urothelial carcinoma.
21377447 These findings suggest that ALK2(L196P) is an activated BMP receptor equivalent to ALK2(R206H) and that ALK2(L196P) activity may be suppressed in vivo by a novel molecular mechanism in fibrodysplasia ossificans progressiva patients with this mutation.
21297076 ACVR1 is associated with acute lung injury in mice
21248739 These data indicate that in the context of a Down's syndrome background, ALK2-mediated reduction of BMP signaling may contribute to congenital heart defects.
20736820 in two cases of fibrodysplasia ossificans progressiva, heterozygous missense mutation 617G>A (R206H) was found
20734064 Observational study of gene-disease association. (HuGE Navigator)
20716560 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20577760 Progressive heterotopic ossification along with congenital malformation of the great toes, the two major clinical features that define classic FOP, led to a suspicion of FOP and to the definitive screening of the ACVR1 gene
20463014 The impact of ACVR1 R206H mutation on BMP signaling and its downstream signaling cascades in murine myogenic C2C12 cells and HEK 293 cells, was studied.
20011542 Of 51 microsatellite stable colon tumors, 7 (14%) lost ACVR2, 2 (4%) ACVR1, and 5 (10%) pSMAD2 expression.
19996292 BMP9 acts as a proliferative factor for immortalized ovarian surface epithelial cells and ovarian cancer cell lines, signaling predominantly through an ALK2/Smad1/Smad4 pathway, the major BMP9 receptor in endothelial cells.
19929436 The R206H mutation in ALK2 confers constitutive activity to the mutant receptor, sensitizes mesenchymal cells to BMP-induced osteoblast differentiation, and stimulates new bone formation.
19896889 The discovery of the FOP metamorphogene reveals a highly conserved target for drug development and identifies a fundamental defect in the BMP signaling pathway that when triggered by injury and inflammation transforms one tissue into another.
19796185 a variant of fibrodysplasia ossificans progressiva phenotypes are associated with specific mutations in ACVR1 gene
19736306 Endoglin is phosphorylated on cytosolic domain threonine residues by the TGF-beta type I receptors ALK2 in prostate cancer cells. In the presence of constitutively active ALK2, endoglin did not inhibit cell migration
19574343 Observational study of gene-disease association. (HuGE Navigator)
19543505 ACVR1 gene mutations were found heterozygous point mutation of c.617G>A; p.R206H in Myositis Ossificans.
19506109 Dominant-negative ALK2 allele associates with congenital heart defects.
19400542 NOG & 617G>A activin A type I receptor(ACVRI)mutations in 27 fibrodysplasia ossificans patients; 5 NOG mutations found in 7 patients; 617G>A mutation in ACVR1 gene found in 14 patients; with 1 exception, 617G>A & NOG mutations were mutually exclusive
19335617 Data show that co-expressing constitutively active type I and type II receptors resulted in the phosphorylation of both R-Smad subclasses in a ligand-independent manner.
19330033 two further unique mutations (c.605G>T and c.983G>A) in this gene in two FOP patients; disparate missense mutations mapped to the GS and kinase domains of the protein supports the disease model of mild kinase activation
19300893 This study aimed to investigate the ACVR1 gene mutation in Chinese FOP patients. Direct sequence analysis of genomic DNA and restriction enzyme digestion demonstrated the presence of a single heterozygous mutation in the ACVR1 gene in both patients.
19299629 Observational study of gene-disease association. (HuGE Navigator)
19148527 activin inhibits the growth of SNU-16 cells by inducing apoptosis through caspase activation.
19085907 Study showed that all patients examined have heterozygous ACVR1 missense mutations in conserved amino acids.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19028479 The serum activin A level, increased in AMI, was positively correlated with peak CK and CK-MB levels which are measures of infarction size.
18952055 ALK2(G356D) activities found in Japanese fibrodysplasia ossificans progressiva patient were weaker than those of ALK2(R206H), and they were suppressed by a specific inhibitor of the BMP-regulated Smad pathway.
18854405 ALK2 signalling contributes to the disturbed folliculogenesis in polycystic ovary syndrome (PCOS) patients.
18854405 Observational study of gene-disease association. (HuGE Navigator)
18830232 The novel amino-acid substitution is predicted to influence either the conformation/stability of the GS region or the binding affinity with FKBP12, resulting in a less stringent inhibitory control on the ACVR1 kinase activity.
18684712 ALK2(R206H) with Smad1 or Smad5 induced osteoblastic differentiation that could be inhibited by Smad7 or dorsomorphin.
18292470 there was significant down-regulation of ALK-2 expression in asthma patients at baseline; allergy challenge was associated with upregulation
18234825 Together, these findings show that TGFbeta superfamily activation of Smad2/3 is required for repression of spontaneous differentiation under strain.
18019378 Various mutations may occur in myositis ossificans nuclear families.
17572636 In both the wild-type ACVR1 model and template crystal structures (TbetaRI), the conserved arginine appears to form a salt bridge with an invariant aspartate residue.
17496924 knockdown of ALK2, but not TGFbetaRI (ALK5), abrogated endoglin-mediated decreases in cell motility and constitutively active ALK2 was sufficient to restore a low-motility phenotype in endoglin deficient cells
17351709 Study examined 3 Japanese patients with Fibrodysplasia ossificans progressiva for ACVR1 mutations and identified the 617G>A mutation in all 3 patients; results suggest that the mutation in the ACVR1 gene is common and recurrent in the global population.
16642017 We mapped fibrodysplasia ossificans progressiva to chromosome 2q23-24 by linkage analysis and identified an identical heterozygous mutation (617G --> A; R206H) in the glycine-serine (GS) activation domain of ACVR1
11969340 distribution in gestational tissues across human pregnancy and during labour

AA Sequence

MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC      1 - 70
FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLAC     71 - 140
LLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITL    141 - 210
LECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLW    211 - 280
LITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQC    281 - 350
CIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS    351 - 420
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALR    421 - 490
IKKTLTKIDNSLDKLKTDC                                                       491 - 509
//

Text Mined References (106)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26776312 2016 Common mutations in ALK2/ACVR1, a multi-faceted receptor, have roles in distinct pediatric musculoskeletal and neural orphan disorders.
26621707 2015 Neofunction of ACVR1 in fibrodysplasia ossificans progressiva.
26597752 2015 Effects of normal and high circulating concentrations of activin A on vascular endothelial cell functions and vasoactive factor production.
26133550 2015 Uncovering Molecular Bases Underlying Bone Morphogenetic Protein Receptor Inhibitor Selectivity.
26097044 2015 Multi-system involvement in a severe variant of fibrodysplasia ossificans progressiva (ACVR1 c.772G>A; R258G): A report of two patients.
26058333 2015 Classical and atypical Fibrodysplasia Ossificans Progressiva in India.
25271001 2015 Regulatory MiR-148a-ACVR1/BMP circuit defines a cancer stem cell-like aggressive subtype of hepatocellular carcinoma.
25101911 2014 Structure-activity relationship of 3,5-diaryl-2-aminopyridine ALK2 inhibitors reveals unaltered binding affinity for fibrodysplasia ossificans progressiva causing mutants.
24798338 2014 Fibrodysplasia ossificans progressiva-related activated activin-like kinase signaling enhances osteoclast formation during heterotopic ossification in muscle tissues.
24705254 2014 Genomic analysis of diffuse intrinsic pontine gliomas identifies three molecular subgroups and recurrent activating ACVR1 mutations.
24705252 2014 Recurrent activating ACVR1 mutations in diffuse intrinsic pontine glioma.
24705251 2014 The genomic landscape of diffuse intrinsic pontine glioma and pediatric non-brainstem high-grade glioma.
24705250 2014 Recurrent somatic mutations in ACVR1 in pediatric midline high-grade astrocytoma.
24347165 2014 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-? signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24047559 2013 Identification and characterization of regulatory elements in the promoter of ACVR1, the gene mutated in Fibrodysplasia Ossificans Progressiva.
23918320 2014 Fibrodysplasia ossificans progressiva: three Indian patients with mutation in the ACVR1 gene.
23260810 2013 ACVR1 gene mutations in four Turkish patients diagnosed as fibrodysplasia ossificans progressiva.
23227223 2012 The role of the 3'UTR region in the regulation of the ACVR1/Alk-2 gene expression.
23169291 2012 Suppression of activin A signals inhibits growth of malignant pleural mesothelioma cells.
23142694 2013 ALK2 and BMPR2 knockdown and endothelin-1 production by pulmonary microvascular endothelial cells.
22977237 2012 Structure of the bone morphogenetic protein receptor ALK2 and implications for fibrodysplasia ossificans progressiva.
22971142 2012 Common genetic variants of the BMP4, BMPR1A, BMPR1B, and ACVR1 genes, left ventricular mass, and other parameters of the heart in newborns.
22949078 2012 Pathogenic mutation of ALK2 inhibits induced pluripotent stem cell reprogramming and maintenance: mechanisms of reprogramming and strategy for drug identification.
22884369 2012 Secreted stress-induced phosphoprotein 1 activates the ALK2-SMAD signaling pathways and promotes cell proliferation of ovarian cancer cells.
22748444 2012 Confirmation of the recurrent ACVR1 617G>A mutation in South Africans with fibrodysplasia ossificans progressiva.
22630080 2012 Deregulated bone morphogenetic protein receptor signaling underlies fibrodysplasia ossificans progressiva.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22408438 2012 ACVR1, a therapeutic target of fibrodysplasia ossificans progressiva, is negatively regulated by miR-148a.
21878751 MicroRNA-30c promotes human adipocyte differentiation and co-represses PAI-1 and ALK2.
21668474 2011 Recurrent copy number gains of ACVR1 and corresponding transcript overexpression are associated with survival in head and neck squamous cell carcinomas.
21617230 2011 Prognostic effects and regulation of activin A, maspin, and the androgen receptor in upper urinary tract urothelial carcinoma.
21377447 2011 A novel mutation of ALK2, L196P, found in the most benign case of fibrodysplasia ossificans progressiva activates BMP-specific intracellular signaling equivalent to a typical mutation, R206H.
21297076 2011 Haplotype association mapping of acute lung injury in mice implicates activin a receptor, type 1.
21248739 2011 ALK2 mutation in a patient with Down's syndrome and a congenital heart defect.
20736820 2010 Report of two FOP cases with 617G>A mutation in the ACVR1 gene from Chinese population.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20577760 2010 Fibrodysplasia ossificans progressiva (FOP): watch the great toes!
20463014 2010 Molecular consequences of the ACVR1(R206H) mutation of fibrodysplasia ossificans progressiva.
20011542 2009 Activin signaling in microsatellite stable colon cancers is disrupted by a combination of genetic and epigenetic mechanisms.
19996292 2009 Autocrine bone morphogenetic protein-9 signals through activin receptor-like kinase-2/Smad1/Smad4 to promote ovarian cancer cell proliferation.
19929436 2010 ALK2 R206H mutation linked to fibrodysplasia ossificans progressiva confers constitutive activity to the BMP type I receptor and sensitizes mesenchymal cells to BMP-induced osteoblast differentiation and bone formation.
19896889 The FOP metamorphogene encodes a novel type I receptor that dysregulates BMP signaling.
19796185 2010 Mutational screening of ACVR1 gene in Brazilian fibrodysplasia ossificans progressiva patients.
19736306 2010 Endoglin phosphorylation by ALK2 contributes to the regulation of prostate cancer cell migration.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19543505 2009 ACVR1 gene mutation in sporadic Korean patients with fibrodysplasia ossificans progressiva.
19506109 2009 Dominant-negative ALK2 allele associates with congenital heart defects.
19400542 2009 Mutations of the noggin (NOG) and of the activin A type I receptor (ACVR1) genes in a series of twenty-seven French fibrodysplasia ossificans progressiva (FOP) patients.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19335617 2009 Receptor expression modulates the specificity of transforming growth factor-beta signaling pathways.
19330033 2009 Novel mutations in ACVR1 result in atypical features in two fibrodysplasia ossificans progressiva patients.
19300893 2009 A recurrent mutation c.617G>A in the ACVR1 gene causes fibrodysplasia ossificans progressiva in two Chinese patients.
19299629 2009 Sequencing of TGF-beta pathway genes in familial cases of intracranial aneurysm.
19148527 2009 Cell growth regulation through apoptosis by activin in human gastric cancer SNU-16 cell lines.
19085907 2009 Classic and atypical fibrodysplasia ossificans progressiva (FOP) phenotypes are caused by mutations in the bone morphogenetic protein (BMP) type I receptor ACVR1.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19028479 2009 Relationship between activin A level and infarct size in patients with acute myocardial infarction undergoing successful primary coronary intervention.
18952055 2008 A unique mutation of ALK2, G356D, found in a patient with fibrodysplasia ossificans progressiva is a moderately activated BMP type I receptor.
18854405 2009 Variants in the ACVR1 gene are associated with AMH levels in women with polycystic ovary syndrome.
18830232 2009 Mutational analysis of the ACVR1 gene in Italian patients affected with fibrodysplasia ossificans progressiva: confirmations and advancements.
18684712 2009 Constitutively activated ALK2 and increased SMAD1/5 cooperatively induce bone morphogenetic protein signaling in fibrodysplasia ossificans progressiva.
18436533 2008 BMP-2/4 and BMP-6/7 differentially utilize cell surface receptors to induce osteoblastic differentiation of human bone marrow-derived mesenchymal stem cells.
18326817 2008 Hemojuvelin regulates hepcidin expression via a selective subset of BMP ligands and receptors independently of neogenin.
18292470 2008 Basal expression of bone morphogenetic protein receptor is reduced in mild asthma.
18234825 2008 TGFbeta/Activin/Nodal pathway in inhibition of human embryonic stem cell differentiation by mechanical strain.
18019378 2007 Mutations of the noggin and of the activin A type I receptor genes in fibrodysplasia ossificans progressiva (FOP).
17572636 2007 Functional modeling of the ACVR1 (R206H) mutation in FOP.
17496924 2007 Endoglin inhibits prostate cancer motility via activation of the ALK2-Smad1 pathway.
17351709 2007 The ACVR1 617G>A mutation is also recurrent in three Japanese patients with fibrodysplasia ossificans progressiva.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16642017 2006 A recurrent mutation in the BMP type I receptor ACVR1 causes inherited and sporadic fibrodysplasia ossificans progressiva.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12702211 2003 Activin-A up-regulates type I activin receptor mRNA levels in human immortalized extravillous trophoblast cells.
12651901 2003 Inhibin, activin, follistatin, activin receptors and beta-glycan gene expression in the placental tissue of patients with pre-eclampsia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065756 2002 SB-431542 is a potent and specific inhibitor of transforming growth factor-beta superfamily type I activin receptor-like kinase (ALK) receptors ALK4, ALK5, and ALK7.
12032389 2002 The physiology and pathophysiology of inhibin, activin and follistatin in female reproduction.
11969340 2002 The distribution of activin and activin receptors in gestational tissues across human pregnancy and during labour.
11266516 2001 Modulation of activin signal transduction by inhibin B and inhibin-binding protein (INhBP).
11069203 2000 Activin A and activin receptors in the human thyroid: a link to the female predominance of goiter?
10665670 1999 A de novo heterozygous deletion of 42 base-pairs in the noggin gene of a fibrodysplasia ossificans progressiva patient.
10652350 2000 Smad and AML proteins synergistically confer transforming growth factor beta1 responsiveness to human germ-line IgA genes.
10631143 2000 Fibrodysplasia ossificans progressiva, a heritable disorder of severe heterotopic ossification, maps to human chromosome 4q27-31.
10583507 1999 Smad8B, a Smad8 splice variant lacking the SSXS site that inhibits Smad8-mediated signalling.
10085121 1999 MEKK-1, a component of the stress (stress-activated protein kinase/c-Jun N-terminal kinase) pathway, can selectively activate Smad2-mediated transcriptional activation in endothelial cells.
9884026 1998 The role of activin type I receptors in activin A-induced growth arrest and apoptosis in mouse B-cell hybridoma cells.
9872992 1999 Endoglin is an accessory protein that interacts with the signaling receptor complex of multiple members of the transforming growth factor-beta superfamily.
9748228 1998 Specific activation of Smad1 signaling pathways by the BMP7 type I receptor, ALK2.
9501322 1998 Chromosomal localization of three human genes encoding members of the TGF-beta superfamily of type I serine/threonine kinase receptors.
9267036 1997 Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300.
9136927 1997 The TGF-beta family mediator Smad1 is phosphorylated directly and activated functionally by the BMP receptor kinase.
8702914 1996 Identification of type I and type II serine/threonine kinase receptors for growth/differentiation factor-5.
8622651 1996 Activation of signalling by the activin receptor complex.
8612709 1996 Truncated activin type II receptors inhibit bioactivity by the formation of heteromeric complexes with activin type I. receptors.
8599089 1996 The p21(RAS) farnesyltransferase alpha subunit in TGF-beta and activin signaling.
8397373 1993 Activin receptor-like kinases: a novel subclass of cell-surface receptors with predicted serine/threonine kinase activity.
8389764 1993 A widely expressed transmembrane serine/threonine kinase that does not bind activin, inhibin, transforming growth factor beta, or bone morphogenic factor.
8248234 1993 Cloning and characterization of a transmembrane serine kinase that acts as an activin type I receptor.
8242742 1993 Identification of human activin and TGF beta type I receptors that form heteromeric kinase complexes with type II receptors.
8006002 1994 Identification of type I receptors for osteogenic protein-1 and bone morphogenetic protein-4.