Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.32
PubTator Score 2.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 3.6e-04
dermatomyositis 1.100 2.6e-03
lung cancer 2.400 1.3e-03
ovarian cancer -1.300 9.5e-10
Parkinson's disease -1.100 3.1e-02
psoriasis 1.100 7.7e-04
Waldenstrons macroglobulinemia 1.011 3.1e-03

Gene RIF (2)

AA Sequence

MTTLVLDNGAYNAKIGYSHENVSVIPNCQFRSKTARLKTFTANQIDEIKDPSGLFYILPFQKGYLVNWDV      1 - 70
QRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQFQAVLRVNAGALSAHRYFRDNP     71 - 140
SELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVC    141 - 210
YVSQDFYRDMDIAKLKGEENTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEI    211 - 280
LFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSLFPGFRDRVYSEVRCLTPTDYDVSVV    281 - 350
LPENPITYAWEGGKLISENDDFEDMVVTREDYEENGHSVCEEKFDI                            351 - 396
//

Text Mined References (14)

PMID Year Title