Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.20
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.900 1.0e-02
posterior fossa group A ependymoma -1.600 4.1e-06
oligodendroglioma -1.500 1.4e-17
psoriasis -1.200 6.8e-09
glioblastoma -2.300 2.6e-05
atypical teratoid / rhabdoid tumor -2.200 5.4e-05
medulloblastoma, large-cell -1.900 4.0e-04
primitive neuroectodermal tumor -1.700 9.9e-04
colon cancer 1.400 3.1e-05
lung cancer 1.800 7.3e-04
pediatric high grade glioma -1.600 4.0e-04
pilocytic astrocytoma -2.400 4.4e-07
non-inflammatory breast cancer -1.200 5.7e-03
Pick disease -1.400 2.8e-02

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14651955 Thus, overexpression of Arp11 may suppress tumorigenicity in nude mice.

AA Sequence

MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKP      1 - 70
TYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLY     71 - 140
IAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRE    141 - 210
REVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPE    211 - 280
IFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS    281 - 350
EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS      351 - 418
//

Text Mined References (15)

PMID Year Title
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15176487 2004 Derangement of hypothetical proteins in fetal Down's syndrome brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651955 2003 Expression of the Arp11 gene suppresses the tumorigenicity of PC-14 human lung adenocarcinoma cells.
12857853 2003 Interactions between the evolutionarily conserved, actin-related protein, Arp11, actin, and Arp1.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11162478 2001 Isolation of a novel actin-related gene expressed in low-metastatic PC-14 human lung adenocarcinoma.
10806390 2000 ARP3beta, the gene encoding a new human actin-related protein, is alternatively spliced and predominantly expressed in brain neuronal cells.
10047519 1999 The Arp2/3 complex: a multifunctional actin organizer.