Property Summary

NCBI Gene PubMed Count 34
PubMed Score 6.08
PubTator Score 45.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.100 1.8e-05
osteosarcoma -2.941 1.4e-08
diabetes mellitus -1.400 1.4e-03
posterior fossa group B ependymoma -1.100 9.3e-13
ovarian cancer 1.100 3.6e-04

 GO Function (1)

Gene RIF (2)

PMID Text
18303113 point mutation observed by transcriptome sequencing of malignant pleural mesothelioma tumors
12871323 ARP1 interacted with two regions of the FVII 5' flanking region, the hepatic nuclear factor 4 binding region and the nuclear hormone response region, indicating a role for ARP1 in transcriptional modulation of the FVII gene.

AA Sequence

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLS      1 - 70
IRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFIS     71 - 140
MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSE    141 - 210
FEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLV    211 - 280
FAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASL    281 - 350
DTFKKMWVSKKEYEEDGARSIHRKTF                                                351 - 376
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18303113 2008 Transcriptome sequencing of malignant pleural mesothelioma tumors.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12871323 2003 ARP1 interacts with the 5' flanking region of the coagulation factor VII gene.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11461920 2001 beta III spectrin binds to the Arp1 subunit of dynactin.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10671518 2000 A dynactin subunit with a highly conserved cysteine-rich motif interacts directly with Arp1.
10671377 2000 ARP1 in Golgi organisation and attachment of manchette microtubules to the nucleus during mammalian spermatogenesis.
10607828 2000 Human centromeres and neocentromeres show identical distribution patterns of >20 functionally important kinetochore-associated proteins.
10504299 1999 Overexpression of normal and mutant Arp1alpha (centractin) differentially affects microtubule organization during mitosis and interphase.
10196146 1999 Specific isoforms of actin-binding proteins on distinct populations of Golgi-derived vesicles.
10074429 1999 Self-regulated polymerization of the actin-related protein Arp1.
9499420 1998 Localization of motor-related proteins and associated complexes to active, but not inactive, centromeres.
8991093 1996 Centractin (ARP1) associates with spectrin revealing a potential mechanism to link dynactin to intracellular organelles.
7878030 1995 The p150Glued component of the dynactin complex binds to both microtubules and the actin-related protein centractin (Arp-1).
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7696711 1994 Beta-centractin: characterization and distribution of a new member of the centractin family of actin-related proteins.
7518465 1994 Ultrastructural analysis of the dynactin complex: an actin-related protein is a component of a filament that resembles F-actin.
1528266 1992 A vertebrate actin-related protein is a component of a multisubunit complex involved in microtubule-based vesicle motility.
1356230 1992 Centractin is an actin homologue associated with the centrosome.