Property Summary

NCBI Gene PubMed Count 208
PubMed Score 697.57
PubTator Score 726.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.500 2.6e-40

Gene RIF (130)

PMID Text
26493222 Upon actin engagement, the N-terminal "strap" and helix 1 are displaced from the vinculin tail helical bundle to mediate actin bundling.
26295568 The authors propose that Lpd delivers Ena/VASP proteins to growing barbed ends and increases their actin polymerase activity by tethering them to actin filaments.
26172852 This study reported the new information on the frequency and phenotypes of congenital myopathy caused by ACTA1 mutations in subjects >/=5 years of age.
25938801 New scapuloperoneal phenotype associated with an ACTA1 mutation.
25913210 Mutations in ACTA1 can cause pathologic features consistent with myofibrillar myopathy.
25895516 TIMP-1 significantly increased levels of alpha-SMA.
25747004 Myopathy associated with zebra bodies is part of the spectrum of myopathies associated with the ACTA1 gene.
25746564 Antisynthetase syndrome-associated myositis is characterized by distinctive myonuclear actin filament inclusions.
25745180 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
25527710 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
25231990 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
25182138 novel homozygous recessive missense variant (c.460G>C, P.(Val154Leu)) was found in two brothers with infantile-onset congenital muscular dystrophy with rigid spine.
24789789 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
24789788 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
24778234 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
24742657 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
24706755 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
24576301 The predominant pathway mediated by Australian bat lyssavirus G envelope for internalization into HEK293T cells is clathrin-and actin-dependent also requiring Rab5.
24313005 Although most cases of severe infantile form of nemaline myopathy caused by ACTA1 mutations are sporadic and have no family history
24307588 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23875777 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23831272 Data show that the width and speed of the waves depend counter-intuitively on parameters, negative feedback, and the F-actin time scale.
23811015 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23656990 Respiratory muscles from an animal model of nemaline myopathy with an ACTA1 mutation show distinct muscle fiber weakness compared to limb muscles.
23575248 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23420843 analysis of the pattern of of evolutionarily conserved basic and acidic residues that constitutes the binding interface of actin-tropomyosin
23376163 These findings suggest that the direct contact of Dengue virus 2 E protein with 43 kDa actin protein may have a crucial function in Dengue virus 2 infection of ECV304 cells.
23294842 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23260110 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23247112 Myotonia in adult human skeletal actin transgenic mice may be explained on the basis of a mosaic expression of ClC-1 channels in different fibres and/or on alterations of other conductances.
23229356 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23178941 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23176180 Data show that GnRHR activation affected several cellular markers of locomotion, including actin organization and polymerization as well as active RhoA-GTP levels.
23174700 The objective was to evaluate the presence and distribution of the lubricating and anti-adhesion glycoprotein lubricin and cells containing the contractile isoform smooth muscle alpha-actin (SMA) in pseudomembranes around loose hip prostheses.
23071671 Data indicate that actin nucleation on Chlamydia inclusions exhibited moderate depolymerization dynamics.
23071112 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
23042265 The organization of actin and cytokeratin cytoskeleton and the expression of TCTP, p53,cyclin A, RhoA and actin in HIO180 non-transformed ovarian epithelial cells, and OVCAR3 and SKOV3 ovarian epithelial cancer cells, was studied.
23017337 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22989508 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22721673 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22640593 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22537596 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22535526 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22465675 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22362758 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22209233 CK2 regulates vaccinia virus dissemination and actin tail formation.
22081313 Platelets gal-1 forms an intracellular complex with monomeric actin.
22031939 Actin playes differential roles in trafficking of Epstein-Barr virus in B cells and epithelial cells.
22028271 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22017400 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
22004035 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
21994736 Herpesviruses exploit actin and actin-associated myosin motors for viral entry and virion egress. [review]
21994733 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
21975552 The filopodium: a stable structure with highly regulated repetitive cycles of elongation and persistence depending on the actin cross-linker fascin
21931536 Actin accumulates throughout the activated immunological synapse.
21923909 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
21917091 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
21912905 High alpha-actin is associated with colorectal carcinogenesis.
21824169 Data show that the urinary messenger RNA (mRNA) levels of alpha-smooth muscle actin (alpha-SMA), fibronectin, and matrix metalloproteinase-9 (MMP-9) were significantly higher in the diabetic nephropathy (DN) group, and mRNA levels increased with DN progression.
21691712 Over-expression of Nkx2.5 and/or cardiac alpha-actin inhibit the contraction ability of adipose tissue-derived stromal cells-derived cardiomyocytes.
21606541 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
21514153 a link between extramuscular expression of alpha-skeletal muscle actin and clinical symptoms in non-skeletal muscle tissues of patients with ACTA1 mutations, and probably a functional role of alpha-skeletal muscle actin during fetal development
21340023 Actin-EGFP and ezrin-EGFP accumulated below pilus-coated beads when force was applied.
21199870 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
21108927 Centrosomal actin was detected with the anti-actin antibody 1C7 that recognizes antiparallel ("lower dimer") actin dimers.
21079800 Data show that concurrent phosphorylation of cortactin by ERK1/2 and tyrosine kinases enables cells with the ability to regulate actin dynamics.
20826790 Results suggest that actin polymerization and bundling by VASP are critical for spine formation, expansion, and modulating synaptic strength.
20809254 These findings demonstrated that PI3K-mediated actin rearrangements are required for Cronobacter sakazakii invasion of human brain microvascular endothelial cells.
20718862 Results confirm that DNaseI-binding loop (D-loop) is involved in stabilization of skeletal muscle actin structure, both as monomers and filaments; actin is stabilized by ligands (by phalloidin, aluminum fluoride, & ATP [and to lesser extent by ADP]).
20716950 BCL2 interaction with actin in vitro may inhibit cell motility by enhancing actin polymerization
20686692 Simultaneous tracking of both TCR clusters and GFP-actin speckles reveals their dynamic association and individual flow patterns. Actin retrograde flow directs the inward transport of TCR clusters
20630939 Podocyte BK(Ca) channels are regulated by synaptopodin, Rho, and actin microfilaments.
20452215 We conclude that the Drosophila indirect flight muscles provide a good model system for studying ACTA1 mutations
20388088 Observational study of gene-disease association. (HuGE Navigator)
20378355 Observational study of gene-disease association. (HuGE Navigator)
20332100 these data identify NHS as a new regulator of actin remodelling.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20179953 ACTA1 mutations are involved in fiber size disproportion in congenital myotonic dystrophy
20169155 Data demonstrate for the first time that L-plastin contributes to the fine-tuning of actin turn-over, an activity which is regulated by Ser5 phosphorylation promoting its high affinity binding to the cytoskeleton.
20147394 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
20100475 First insights of S100A10 function as a regulator of the filamentous actin network.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19934221 Asef2 activates Rac1 to modulate adhesion and actin dynamics and thereby regulate cell migration
19883584 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
19819966 Data identify a novel signaling pathway in the endocrine L cell, whereby Cdc42 regulates actin remodeling, activation of the cannonical 1/2-ERK1/2 pathway and PAK1, and GLP-1 secretion in response to insulin.
19710135 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
19639585 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
19635823 In summary, these results suggest that actin, likely modulated by the GTPases RhoA and Cdc42 and by bacterial proteins, is involved in the formation of the typical parasitophorous vacuole.
19634497 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19562689 description of 177 different disease-causing ACTA1 mutations, including 85 that have not been described before
19454010 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
19389844 Low plasma gelsolin and detectable circulating actin identify chronic hemodialysis patients at highest risk for 1-year mortality.
19383239 This study shows that the disappearance of CD34-positive stromal cells and appearance of alpha-SMA-positive stromal myofibroblasts may be associated with transformation of cervical cervical intraepithelial neoplasias to squamous cell carcinomas.
19150851 progressive immobilization of Fc epsilon RI during aggregation was sensitive to syk or actin polymerization inhibition. Therefore, desensitization is also not dependent on receptor immobilization.
19002257 circulating actin are associated with early sepsis
18976909 congenital myopathy-causing ACTA1 mutations (Review)
18775311 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
18461503 Nemaline myopathy with exclusively intranuclear rods and a novel mutation in ACTA1 (Q139H).
18443296 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
18063690 Regulation of skeletal alpha-actin by androgens/SARMs may represent an important model system for understanding androgen anabolic action in the muscle.
17504171 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
17411366 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
17387733 These data suggest that ACTA1 congenital fiber type disproportion (CFTD) mutations cause weakness by disrupting sarcomere function rather than structure.
17360745 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
16945536 Here we report for the first time three patients with severe nemaline myopathy and mutations of the ACTA1 stop codon: TAG>TAT (tyrosine), TAG>CAG (glutamine) and TAG>TGG (tryptophan).
16526095 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
16427282 A heterozygous GTG-ATG mutation (Val163Met) was found in exon 4 of ACTA1 in affected individuals with nemaline myopathy with intranuclear rods.
15679046 Enhanced expression of alpha skeletal muscle actin is associated with liver metastases from gastrointestinal tumours
15520409 Missense mutations of ACTA1 cause an autosomal dominant congenital myopathy with cores.
15468086 Three heterozygous missense mutations of the skeletal muscle alpha actin gene (ACTA1) in three unrelated cases of congenital fiber type disproportion (CFTD) from Japan and Australia.
15336687 two csae of nemaline myopathy showed novel mutations in the skeletal muscle aphaa-actin gene, one had g268d mutation and other had mutation, K373E.
15236405 Results describe clinical and pathological features associated with 29 alpha-actin (ACTA1) mutations found in 38 individuals with nemaline myopathy from 28 families.
15072110 Actin-related myopathy may occur without any missense mutation in the ACTA1 gene
14694110 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
14684598 IGF-I-induced activation of the skeletal alpha-actin promoter is regulated by the L-type VGCC and calcineurin but independent of nuclear factor of activated T-cell transcriptional activity as C2C12 myoblasts differentiate into myotubes.
12210873 Observational study of gene-disease association. (HuGE Navigator)
12009869 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
11709093 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
11702052 Observational study of gene-disease association. (HuGE Navigator)
10556093 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
10074138 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
10049817 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
9971772 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
9841925 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
8997639 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
8892894 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
8661406 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
1991513 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
1907279 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages
1540415 HIV-1 Nef stabilizes podosomes and enhances the size of the F-actin core in human monocyte-derived macrophages

AA Sequence

MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK      1 - 70
YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA     71 - 140
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI    141 - 210
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT    211 - 280
YNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS    281 - 350
LSTFQQMWITKQEYDEAGPSIVHRKCF                                               351 - 377
//

Text Mined References (217)

PMID Year Title
26493222 2016 The Structural Basis of Actin Organization by Vinculin and Metavinculin.
26295568 2015 Lamellipodin promotes actin assembly by clustering Ena/VASP proteins and tethering them to actin filaments.
26228148 2015 ACTIN-DIRECTED TOXIN. ACD toxin-produced actin oligomers poison formin-controlled actin polymerization.
26172852 2016 Prevalence and phenotypes of congenital myopathy due to ?-actin 1 gene mutations.
25938801 2015 Association of a Novel ACTA1 Mutation With a Dominant Progressive Scapuloperoneal Myopathy in an Extended Family.
25913210 2015 Severe congenital actin related myopathy with myofibrillar myopathy features.
25895516 2015 TIMP-1 Induces ?-Smooth Muscle Actin in Fibroblasts to Promote Urethral Scar Formation.
25747004 2015 Zebra body myopathy is caused by a mutation in the skeletal muscle actin gene (ACTA1).
25746564 2015 Nuclear actin aggregation is a hallmark of anti-synthetase syndrome-induced dysimmune myopathy.
25182138 2015 Recessive ACTA1 variant causes congenital muscular dystrophy with rigid spine.
24576301 2014 Host cell virus entry mediated by Australian bat lyssavirus G envelope glycoprotein occurs through a clathrin-mediated endocytic pathway that requires actin and Rab5.
24313005 2013 [Sibling cases of severe infantile form of nemaline myopathy with ACTA1-gene mutation].
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23831272 2013 A model for intracellular actin waves explored by nonlinear local perturbation analysis.
23673617 2013 ALKBH4-dependent demethylation of actin regulates actomyosin dynamics.
23656990 2013 Distinct underlying mechanisms of limb and respiratory muscle fiber weaknesses in nemaline myopathy.
23650303 2013 Nemaline myopathy with dilated cardiomyopathy in childhood.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23420843 2013 A periodic pattern of evolutionarily conserved basic and acidic residues constitutes the binding interface of actin-tropomyosin.
23376163 2013 Identification and characterization of a 43 kDa actin protein involved in the DENV-2 binding and infection of ECV304 cells.
23247112 2013 Age-dependent chloride channel expression in skeletal muscle fibres of normal and HSA(LR) myotonic mice.
23176180 2012 Gonadotropin-releasing hormone receptor activates GTPase RhoA and inhibits cell invasion in the breast cancer cell line MDA-MB-231.
23174700 2013 Lubricin and smooth muscle ?-actin-containing myofibroblasts in the pseudomembranes around loose hip and knee prostheses.
23071671 2012 Actin recruitment to the Chlamydia inclusion is spatiotemporally regulated by a mechanism that requires host and bacterial factors.
23042265 2012 Inverse relationship between TCTP/RhoA and p53 /cyclin A/actin expression in ovarian cancer cells.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22442437 2012 Nemaline myopathy with stiffness and hypertonia associated with an ACTA1 mutation.
22209233 2012 Casein kinase 2 regulates vaccinia virus actin tail formation.
22081313 2012 Isolation of galectin-1 from human platelets: its interaction with actin.
22031939 2012 Important but differential roles for actin in trafficking of Epstein-Barr virus in B cells and epithelial cells.
21994736 2011 Actin in herpesvirus infection.
21975552 The filopodium: a stable structure with highly regulated repetitive cycles of elongation and persistence depending on the actin cross-linker fascin.
21931536 2011 Natural killer cell lytic granule secretion occurs through a pervasive actin network at the immune synapse.
21912905 2012 Increase of ?-SMA(+) and CK (+) cells as an early sign of epithelial-mesenchymal transition during colorectal carcinogenesis.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21824169 2012 Urinary mRNA markers of epithelial-mesenchymal transition correlate with progression of diabetic nephropathy.
21691712 2012 Over-expression of Nkx2.5 and/or cardiac ?-actin inhibit the contraction ability of ADSCs-derived cardiomyocytes.
21514153 2011 Extramuscular manifestations in children with severe congenital myopathy due to ACTA1 gene mutations.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21340023 2011 Rapid cytoskeletal response of epithelial cells to force generation by type IV pili.
21108927 2011 Actin and Arp2/3 localize at the centrosome of interphase cells.
21079800 2010 Cortactin phosphorylated by ERK1/2 localizes to sites of dynamic actin regulation and is required for carcinoma lamellipodia persistence.
20826790 2010 Vasodilator-stimulated phosphoprotein (VASP) induces actin assembly in dendritic spines to promote their development and potentiate synaptic strength.
20809254 2010 PI3K-dependent host cell actin rearrangements are required for Cronobacter sakazakii invasion of human brain microvascular endothelial cells.
20718862 2010 Specific cleavage of the DNase-I binding loop dramatically decreases the thermal stability of actin.
20716950 BCL2 interaction with actin in vitro may inhibit cell motility by enhancing actin polymerization.
20686692 2010 Altered actin centripetal retrograde flow in physically restricted immunological synapses.
20630939 2010 Regulation of podocyte BK(Ca) channels by synaptopodin, Rho, and actin microfilaments.
20452215 2010 Drosophila indirect flight muscle specific Act88F actin mutants as a model system for studying congenital myopathies of the human ACTA1 skeletal muscle actin gene.
20388088 2010 Gene-gene and gene - clinical factors interaction in acute myocardial infarction: a new detailed risk chart.
20378355 2010 Is there an association of regulatory region polymorphism in the alpha-1-antichymotrypsin gene with sporadic Alzheimer's disease in the northern Han-Chinese population?
20332100 2010 The Nance-Horan syndrome protein encodes a functional WAVE homology domain (WHD) and is important for co-ordinating actin remodelling and maintaining cell morphology.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20179953 2010 Congenital myotonic dystrophy can show congenital fiber type disproportion pathology.
20169155 2010 Quantitative kinetic study of the actin-bundling protein L-plastin and of its impact on actin turn-over.
20100475 2010 Regulation of cellular actin architecture by S100A10.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19934221 2009 The Rho-family GEF Asef2 activates Rac to modulate adhesion and actin dynamics and thereby regulate cell migration.
19819966 2009 The rho guanosine 5'-triphosphatase, cell division cycle 42, is required for insulin-induced actin remodeling and glucagon-like peptide-1 secretion in the intestinal endocrine L cell.
19635823 2009 Actin dynamics and Rho GTPases regulate the size and formation of parasitophorous vacuoles containing Coxiella burnetii.
19634497 2009 Gene-gene interaction affects coronary artery disease risk.
19562689 2009 Mutations and polymorphisms of the skeletal muscle alpha-actin gene (ACTA1).
19389844 2009 Plasma gelsolin and circulating actin correlate with hemodialysis mortality.
19383239 Expression of CD34, alpha-smooth muscle actin and transforming growth factor-beta1 in squamous intraepithelial lesions and squamous cell carcinoma of the cervix.
19233165 2009 Myofibril assembly visualized by imaging N-RAP, alpha-actinin, and actin in living cardiomyocytes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19150851 2009 Polymerization of actin does not regulate desensitization in human basophils.
19015515 2008 Connecting actin monomers by iso-peptide bond is a toxicity mechanism of the Vibrio cholerae MARTX toxin.
19002257 2008 Plasma gelsolin depletion and circulating actin in sepsis: a pilot study.
18976909 2009 Genotype-phenotype correlations in ACTA1 mutations that cause congenital myopathies.
18835984 2008 Interaction of the mycobacterial heparin-binding hemagglutinin with actin, as evidenced by single-molecule force spectroscopy.
18461503 2007 Nemaline myopathy with exclusively intranuclear rods and a novel mutation in ACTA1 (Q139H).
18063690 2008 Cell-specific activation of the human skeletal alpha-actin by androgens.
17705262 2007 Intranuclear rod myopathy: molecular pathogenesis and mechanisms of weakness.
17387733 2007 The pathogenesis of ACTA1-related congenital fiber type disproportion.
16945537 2006 Fatal hypertrophic cardiomyopathy and nemaline myopathy associated with ACTA1 K336E mutation.
16945536 2006 Severe nemaline myopathy caused by mutations of the stop codon of the skeletal muscle alpha actin gene (ACTA1).
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16501887 2006 The ubiquitin-specific protease USP25 interacts with three sarcomeric proteins.
16427282 2006 Autosomal dominant nemaline myopathy with intranuclear rods due to mutation of the skeletal muscle ACTA1 gene: clinical and pathological variability within a kindred.
15679046 2004 Collagen type IV, laminin, alpha-smooth muscle actin (alphaSMA), alpha1 and alpha6 integrins expression in the liver with metastases from malignant gastrointestinal tumours.
15520409 2004 Missense mutations of ACTA1 cause dominant congenital myopathy with cores.
15507486 2004 Differential actin binding along the PEVK domain of skeletal muscle titin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15468086 2004 Actin mutations are one cause of congenital fibre type disproportion.
15454575 2004 Xin repeats define a novel actin-binding motif.
15336687 2004 Follow-up of nemaline myopathy in two patients with novel mutations in the skeletal muscle alpha-actin gene (ACTA1).
15236405 2004 Heterogeneity of nemaline myopathy cases with skeletal muscle alpha-actin gene mutations.
15198992 2004 Evidence for a dominant-negative effect in ACTA1 nemaline myopathy caused by abnormal folding, aggregation and altered polymerization of mutant actin isoforms.
15152255 2004 Rab5 is a signalling GTPase involved in actin remodelling by receptor tyrosine kinases.
15107502 2004 Phactrs 1-4: A family of protein phosphatase 1 and actin regulatory proteins.
15072110 2004 Actin-related myopathy without any missense mutation in the ACTA1 gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684598 2004 Insulin-like growth factor-induced transcriptional activity of the skeletal alpha-actin gene is regulated by signaling mechanisms linked to voltage-gated calcium channels during myoblast differentiation.
14668487 2004 Novel kelch-like protein, KLEIP, is involved in actin assembly at cell-cell contact sites of Madin-Darby canine kidney cells.
14640694 2003 Mts1 regulates the assembly of nonmuscle myosin-IIA.
14576350 2003 Fhos, a mammalian formin, directly binds to F-actin via a region N-terminal to the FH1 domain and forms a homotypic complex via the FH2 domain to promote actin fiber formation.
14506234 2003 Tuba, a novel protein containing bin/amphiphysin/Rvs and Dbl homology domains, links dynamin to regulation of the actin cytoskeleton.
12921789 2003 Muscle disease caused by mutations in the skeletal muscle alpha-actin gene (ACTA1).
12857853 2003 Interactions between the evolutionarily conserved, actin-related protein, Arp11, actin, and Arp1.
12849983 2003 Production of human skeletal alpha-actin proteins by the baculovirus expression system.
12721663 2003 Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I.
12714565 2003 AIF-1 is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.
12665555 2003 The formin-homology-domain-containing protein FHOD1 enhances cell migration.
12571245 2003 Actin binding of human LIM and SH3 protein is regulated by cGMP- and cAMP-dependent protein kinase phosphorylation on serine 146.
12534372 2003 Haematopoietic lineage cell-specific protein 1 (HS1) promotes actin-related protein (Arp) 2/3 complex-mediated actin polymerization.
12480535 2003 Association of phospholamban with a cGMP kinase signaling complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475945 2002 Characterization of human alpha-dystrobrevin isoforms in HL-60 human promyelocytic leukemia cells undergoing granulocytic differentiation.
12466270 2003 Characterization of the motor activity of mammalian myosin VIIA.
12417594 2003 The LIM protein Ajuba is recruited to cadherin-dependent cell junctions through an association with alpha-catenin.
12388543 2002 Regulation of phospholipase D activity by actin. Actin exerts bidirectional modulation of Mammalian phospholipase D activity in a polymerization-dependent, isoform-specific manner.
12383268 2002 The inhibitory region of troponin-I alters the ability of F-actin to interact with different segments of myosin.
12210873 2002 ACT and UCH-L1 polymorphisms in Parkinson's disease and age of onset.
12163017 2002 Expression and biological activity of Baculovirus generated wild-type human slow alpha tropomyosin and the Met9Arg mutant responsible for a dominant form of nemaline myopathy.
12127568 2002 Eps8 in the midst of GTPases.
12119014 2002 Crystal structure of the complex between actin and human vitamin D-binding protein at 2.5 A resolution.
12048248 2002 Crystal structures of the vitamin D-binding protein and its complex with actin: structural basis of the actin-scavenger system.
12044158 2002 Functional characterization of spectrin-actin-binding domains in 4.1 family of proteins.
12033495 2002 Functional analysis of rat acidic calponin.
12006649 2002 Utrophin binds laterally along actin filaments and can couple costameric actin with sarcolemma when overexpressed in dystrophin-deficient muscle.
11969288 2002 Dendrite-like process formation and cytoskeletal remodeling regulated by delta-catenin expression.
11950878 2002 Human CAP1 is a key factor in the recycling of cofilin and actin for rapid actin turnover.
11889126 2002 HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.
11877456 2002 CHO1, a mammalian kinesin-like protein, interacts with F-actin and is involved in the terminal phase of cytokinesis.
11850458 2002 Small proline-rich repeat protein 1A is expressed by axotomized neurons and promotes axonal outgrowth.
11839310 2002 Solution structure of the calponin CH domain and fitting to the 3D-helical reconstruction of F-actin:calponin.
11821948 2002 The interaction of p53 with the nuclear matrix is mediated by F-actin and modulated by DNA damage.
11812134 2002 Polymerisation of chemically cross-linked actin:thymosin beta(4) complex to filamentous actin: alteration in helical parameters and visualisation of thymosin beta(4) binding on F-actin.
11795944 2002 Association of the growth-arrest-specific protein Gas7 with F-actin induces reorganization of microfilaments and promotes membrane outgrowth.
11707283 2001 Interaction of ADP-ribosylated actin with actin binding proteins.
11702052 2001 Potential genetic markers of sporadic Alzheimer's dementia.
11701614 2001 Interaction between PEVK-titin and actin filaments: origin of a viscous force component in cardiac myofibrils.
11583571 2001 Coactosin-like protein, a human F-actin-binding protein: critical role of lysine-75.
11580270 2001 Analysis of the interaction between the eukaryotic chaperonin CCT and its substrates actin and tubulin.
11536049 2001 Cloning and characterization of ectopically expressed transcripts for the actin-binding protein MIPP in mouse mammary carcinomas.
11524436 2001 An effector region in Eps8 is responsible for the activation of the Rac-specific GEF activity of Sos-1 and for the proper localization of the Rac-based actin-polymerizing machine.
11481347 2001 Myosin light chain kinase binding to a unique site on F-actin revealed by three-dimensional image reconstruction.
11468283 2001 Inositol 1,4,5-trisphosphate 3-kinase A associates with F-actin and dendritic spines via its N terminus.
11461920 2001 beta III spectrin binds to the Arp1 subunit of dynactin.
11438522 2001 Actin cytoskeletal association of cytohesin-1 is regulated by specific phosphorylation of its carboxyl-terminal polybasic domain.
11429692 2001 Cooperation of Cdc42 small G protein-activating and actin filament-binding activities of frabin in microspike formation.
11415434 2001 Protein kinase C-delta C2-like domain is a binding site for actin and enables actin redistribution in neutrophils.
11333380 2001 Nemaline myopathy caused by mutations in the muscle alpha-skeletal-actin gene.
11309382 2001 Inhibition of c-Abl tyrosine kinase activity by filamentous actin.
11259305 2001 Binding of dystrophin's tandem calponin homology domain to F-actin is modulated by actin's structure.
11171322 2001 Parvin, a 42 kDa focal adhesion protein, related to the alpha-actinin superfamily.
11166164 2001 Mild phenotype of nemaline myopathy with sleep hypoventilation due to a mutation in the skeletal muscle alpha-actin (ACTA1) gene.
11106625 2000 Alteration of tropomyosin function and folding by a nemaline myopathy-causing mutation.
11090452 2000 Actin-binding properties and colocalization with actin during spermiogenesis of mammalian sperm calicin.
11071908 2000 A nonerythroid isoform of protein 4.1R interacts with components of the contractile apparatus in skeletal myofibers.
11053353 2000 Mutagenesis analysis of human SM22: characterization of actin binding.
11027608 2000 Direct interaction of actin with p47(phox) of neutrophil NADPH oxidase.
11018051 2000 Cortactin localization to sites of actin assembly in lamellipodia requires interactions with F-actin and the Arp2/3 complex.
10984435 2000 Myosin-X, a novel myosin with pleckstrin homology domains, associates with regions of dynamic actin.
10958653 2000 Myotilin is mutated in limb girdle muscular dystrophy 1A.
10882740 2000 Phosphorylation of the vasodilator-stimulated phosphoprotein regulates its interaction with actin.
10793131 2000 Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli.
10666339 2000 The carboxy terminus of AFAP-110 modulates direct interactions with actin filaments and regulates its ability to alter actin filament integrity and induce lamellipodia formation.
10628374 Interaction between protein kinase C and actin in megakaryocyte polyploidization.
10601340 1999 Microtubule actin cross-linking factor (MACF): a hybrid of dystonin and dystrophin that can interact with the actin and microtubule cytoskeletons.
10583954 1999 Domain movement in gelsolin: a calcium-activated switch.
10581178 1999 Functional genomic analysis reveals the utility of the I/LWEQ module as a predictor of protein:actin interaction.
10575001 1999 Protein interactions at the tight junction. Actin has multiple binding partners, and ZO-1 forms independent complexes with ZO-2 and ZO-3.
10564664 1999 Caspase-3 and caspase-7 but not caspase-6 cleave Gas2 in vitro: implications for microfilament reorganization during apoptosis.
10559237 1999 Molecular cloning and characterization of human trabeculin-alpha, a giant protein defining a new family of actin-binding proteins.
10508519 1999 Mutations in the skeletal muscle alpha-actin gene in patients with actin myopathy and nemaline myopathy.
10438535 1999 The EVH2 domain of the vasodilator-stimulated phosphoprotein mediates tetramerization, F-actin binding, and actin bundle formation.
10366597 1999 Aip1p interacts with cofilin to disassemble actin filaments.
10224093 1999 A neurally enriched coronin-like protein, ClipinC, is a novel candidate for an actin cytoskeleton-cortical membrane-linking protein.
10072583 1998 Assignment of the human skeletal muscle [FC12]a-actin gene (ACTA1) to chromosome 1q42.13-->q42.2 by radiation hybrid mapping.
9852149 1998 The localization of myosin VI at the golgi complex and leading edge of fibroblasts and its phosphorylation and recruitment into membrane ruffles of A431 cells after growth factor stimulation.
9832551 1998 Nexilin: a novel actin filament-binding protein localized at cell-matrix adherens junction.
9792688 1998 The tight junction protein ZO-1 establishes a link between the transmembrane protein occludin and the actin cytoskeleton.
9724539 1998 A recombinant monocysteine mutant (Ser to Cys-155) of fast skeletal troponin T: identification by cross-linking of a domain involved in a physiologically relevant interaction with troponins C and I.
9668039 1998 Frabin, a novel FGD1-related actin filament-binding protein capable of changing cell shape and activating c-Jun N-terminal kinase.
9645951 1998 Distinct subcellular localization of calcium binding S100 proteins in human smooth muscle cells and their relocation in response to rises in intracellular calcium.
9512503 1998 E-cadherin mediated cell adhesion recruits SAP97 into the cortical cytoskeleton.
9490638 1998 Human myosin-IXb is a mechanochemically active motor and a GAP for rho.
9417078 1998 p140Sra-1 (specifically Rac1-associated protein) is a novel specific target for Rac1 small GTPase.
9298982 1997 Localization of p21-activated kinase 1 (PAK1) to pinocytic vesicles and cortical actin structures in stimulated cells.
9251807 1997 Actin-titin interaction in cardiac myofibrils: probing a physiological role.
9214391 1997 Involvement of ZO-1 in cadherin-based cell adhesion through its direct binding to alpha catenin and actin filaments.
9199170 1997 IQGAP1, a Rac- and Cdc42-binding protein, directly binds and cross-links microfilaments.
8999969 1997 Identification of an actin binding region and a protein kinase C phosphorylation site on human fascin.
8612804 1996 Human mineralocorticoid receptor interacts with actin under mineralocorticoid ligand modulation.
8567732 1996 Identification and localization of an actin-binding motif that is unique to the epsilon isoform of protein kinase C and participates in the regulation of synaptic function.
8422497 1993 Re-localization of Actsk-1 to mouse chromosome 8, a new region of homology with human chromosome 1.
8413665 1993 The structure of crystalline profilin-beta-actin.
8258301 1994 Assignment of the human skeletal muscle alpha actin gene (ACTA1) to 1q42 by fluorescence in situ hybridisation.
7908614 1994 Congenital myopathy with fiber type disproportion: a family with a chromosomal translocation t(10;17) may indicate candidate gene regions.
7908020 1993 Microtubule-associated proteins, MAP 1A and MAP 1B, interact with F-actin in vitro.
7820861 1994 Microtubule associated protein MAP1A is an actin-binding and crosslinking protein.
7816144 1995 F-actin binding site masked by the intramolecular association of vinculin head and tail domains.
7780165 1995 Reexamination of chromosomal loci of human muscle actin genes by fluorescence in situ hybridization.
7703225 1995 Structure of the brain-derived neurotrophic factor/neurotrophin 3 heterodimer.
7680654 1993 Cortactin, an 80/85-kilodalton pp60src substrate, is a filamentous actin-binding protein enriched in the cell cortex.
7503723 1995 Direct binding of F actin to the cytoplasmic domain of the alpha 2 integrin chain in vitro.
6893424 1980 Villin is a major protein of the microvillus cytoskeleton which binds both G and F actin in a calcium-dependent manner.
6865942 1983 Isolation and characterization of full-length cDNA clones for human alpha-, beta-, and gamma-actin mRNAs: skeletal but not cytoplasmic actins have an amino-terminal cysteine that is subsequently removed.
6190133 1983 Isolation and characterization of cDNA clones for human skeletal muscle alpha actin.
3842206 1985 The human beta-actin multigene family.
3793760 1987 Tropomyosin distinguishes between the two actin-binding sites of villin and affects actin-binding properties of other brush border proteins.
2936753 1986 Ultrastructure of the intact skeleton of the human erythrocyte membrane.
2907503 1988 Nucleotide sequence and expression of the human skeletal alpha-actin gene: evolution of functional regulatory domains.
2455687 1988 Vascular smooth muscle calponin. A novel troponin T-like protein.
2395459 1990 Atomic structure of the actin:DNase I complex.
2161834 1990 Smooth muscle calponin. Inhibition of actomyosin MgATPase and regulation by phosphorylation.
1808202 1991 Epidermal growth factor induces rapid reorganization of the actin microfilament system in human A431 cells.
1544421 1992 Binding sites involved in the interaction of actin with the N-terminal region of dystrophin.
1423520 1992 Differentiation of human skeletal muscle cells in culture: maturation as indicated by titin and desmin striation.
1383230 1992 The EGF receptor is an actin-binding protein.
1074709 1976 My franchise was a teen-age lion's den.
648524 1978 Interaction of adenylosuccinate synthetase with F-actin.