Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.21
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 164 3.56 1.8

Expression

Gene RIF (2)

PMID Text
23982661 SNPs associated with rapid AIDS progression
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKIFFRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADVLDQWSQKEKTGE      1 - 70
RPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPCGLQRGDRLAVILPRIPEWWLVNVACIRTGII     71 - 140
FMPGTIQLTAKDILYRLRASKAKCIVASEEVAPAVESIVLECPDLKTKLLVSPQSWNGWLSFQELFQFAS    141 - 210
EEHSCVETGSQEPMTIYFTSGTTGFPKMAQHSQSSLGIGFTLCGRYWLDLKSSDIIWNMSDTGWVKAAIG    211 - 280
SVFSSWLCGACVFVHRMAQFDTDTFLDTLTTYPITTLCSPPTVYRMLVQKDLKRYKFKSLRHCLTGGEPL    281 - 350
NPEVLEQWRVQTGLELYEGYGQTEVGMICANQKGQEIKPGSMGKGMLPYDVQIIDENGNVLPPGKEGEIA    351 - 420
LRLKPTRPFCFFSKYVDNPQKTAATIRGDFYVTGDRGVMDSDGYFWFVGRADDVIISSGYRIGPFEVESA    421 - 490
LIEHPAVVESAVVSSPDQIRGEVVKAFVVLAAPFKSYNPEKLTLELQDHVKKSTAPYKYPRKVEFVQELP    491 - 560
KTITGKIKRNVLRDQEWRGR                                                      561 - 580
//

Text Mined References (4)

PMID Year Title
23982661 2014 ACSM4 polymorphisms are associated with rapid AIDS progression in HIV-infected patients.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17762044 2007 Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.
16541075 2006 The finished DNA sequence of human chromosome 12.