Property Summary

NCBI Gene PubMed Count 23
PubMed Score 72.32
PubTator Score 16.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.300 1.3e-02
astrocytoma -1.100 3.7e-05
glioblastoma -3.800 4.7e-05
osteosarcoma -5.684 3.0e-07
ependymoma -1.900 6.7e-06
sonic hedgehog group medulloblastoma -4.600 4.7e-09
atypical teratoid / rhabdoid tumor -5.100 1.3e-11
medulloblastoma, large-cell -3.400 6.6e-05
primitive neuroectodermal tumor -2.400 8.2e-04
pediatric high grade glioma -3.400 5.5e-06
pilocytic astrocytoma -1.700 6.4e-04
Alzheimer's disease -1.200 1.9e-02
Pick disease -1.500 4.6e-04
pituitary cancer 1.500 3.0e-04

Protein-protein Interaction (2)

Gene RIF (16)

PMID Text
22205969 variations in the ACSL6 gene may contribute to the quantity of cigarettes smoked
20429931 The alternative fatty acid Gate-domain motifs are essential determinants for the activity of the human ACSL6 isoforms, which appear to act as homodimeric enzyme as well as in complex with other spliced forms.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of acyl-CoA synthetase long-chain family member 6 (ACSL6) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19064571 Observational study of gene-disease association. (HuGE Navigator)
18804346 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18718982 ACSL6 is highly associated with schizophrenia and several haplotypes in this haploblock have about twofold to 10-fold increase in the affected subjects in Han Chinese.
18718982 Observational study of gene-disease association. (HuGE Navigator)
18555221 The acyl-coenzyme A synthetase long-chain family member 6 (ACSL6) gene on chromosome 5q31 was associated with premature ovarian failure and identified disease-susceptibility haplotypes.
18555221 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17030554 Observational study of gene-disease association. (HuGE Navigator)
17030554 haplotypes underlying the SPEC2/PDZ-GEF2/ACSL6 region are associated with schizophrenia
16834775 Three ACSL6 spliced variants of a mutually exclusive exon pair are reported, they encode a slightly different short motif which contains a conserved structural domain, the fatty acid Gate domain.
16827919 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
16827919 Analyses did not yield convincing evidence for associations of schizophrenia with ACSL6
16572202 The t(5;12)(q23-31;p13)translocation with ETV6-ACSL6 genomic alteration rearrangement in polycythemia vera patients was reported.

AA Sequence

MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGA      1 - 70
RRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQH     71 - 140
NCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLL    141 - 210
EHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTT    211 - 280
GNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRL    281 - 350
LSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKI    351 - 420
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIK    421 - 490
LVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIF    491 - 560
KLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDL    561 - 630
KKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM       631 - 697
//

Text Mined References (25)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22205969 2011 ACSL6 is associated with the number of cigarettes smoked and its expression is altered by chronic nicotine exposure.
20429931 2010 Activity of the acyl-CoA synthetase ACSL6 isoforms: role of the fatty acid Gate-domains.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18804346 2008 Interaction between interleukin 3 and dystrobrevin-binding protein 1 in schizophrenia.
18718982 2008 Association of haplotypes spanning PDZ-GEF2, LOC728637 and ACSL6 with schizophrenia in Han Chinese.
18555221 2009 Acyl-CoA synthetase long-chain family member 6 is associated with premature ovarian failure.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17030554 2006 Haplotypes spanning SPEC2, PDZ-GEF2 and ACSL6 genes are associated with schizophrenia.
16834775 2006 Multiple erythroid isoforms of human long-chain acyl-CoA synthetases are produced by switch of the fatty acid gate domains.
16827919 2007 DNA pooling: a comprehensive, multi-stage association analysis of ACSL6 and SIRT5 polymorphisms in schizophrenia.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16572202 2006 t(5;12)(q23-31;p13) with ETV6-ACSL6 gene fusion in polycythemia vera.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15292367 2004 Revised nomenclature for the mammalian long-chain acyl-CoA synthetase gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10548543 1999 Identification and molecular characterization of acyl-CoA synthetase in human erythrocytes and erythroid precursors.
10502316 1999 Fusion of TEL/ETV6 to a novel ACS2 in myelodysplastic syndrome and acute myelogenous leukemia with t(5;12)(q31;p13).
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8944226 1996 Biosynthesis of triacylglycerols.