Property Summary

NCBI Gene PubMed Count 32
PubMed Score 94.61
PubTator Score 74.62

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (21)

PMID Text
25356045 ACSL5 mediates antiproliferative activities via Wnt2B palmitoylation with diminished Wnt activity. The molecular pathway is probably relevant for intestinal homeostasis, overwhelmed by other pathways in carcinogenesis.
24770931 Uncoupling of ACSL5 and mitochondrial mortalin by mutated TP53 could be important in colorectal carcinogenesis.
24663101 Depletion of the ACSL5 expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
24222123 Down-regulation of ACSL5 is associated with colorectal cancer.
23348389 Levels of acyl-coenzyme A synthetase 5 in urothelial cells and corresponding neoplasias reflect cellular differentiation.
22171129 The data strongly indicate that human but not rat acyl-CoA synthetase 5 is sensitive to triacsin C and does not compensate for other triacsin C-sensitive ACSL isoforms.
22163040 High ACSL5 transcript levels associate with systemic lupus erythematosus and apoptosis in Jurkat T lymphocytes and peripheral blood cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20470896 Increased ACSL5 is associated with Fatty Liver.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19218499 These results reveal a mechanism for elevated transcription of ACSL5 in skeletal muscle of carriers of the rs2419621(T) allele, associated with more rapid diet-induced weight loss.
18806831 These results indicate that ACSL5 is a critical factor for survival of glioma cells under acidic tumor microenvironment.
18228202 Expression of ACSL5 in human epidermis is reported.
17761945 Oncostatin M directly lowers the plasma triglycerides in hyperlipidemia by stimulating the transcription of ACSL3/5 in the liver.
17681178 Suggest an ACSL5-dependent regulatory mechanism that contributes to the cellular renewal along the crypt-villus axis in human small intestine.
17495181 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17495181 Existence of a link between ACSL5 genotype and diet responsiveness.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16198472 SREBP-1c-mediated insulin regulation of acyl-CoA synthestase 5 expression indicate that ACS-5 is involved in the anabolic fate of fatty acids.
15809837 ACS5 is a very suitable marker molecule for the detection of villus atrophy in the small intestine.
15736044 expression of ACS5 in the gastric body and the small intestine with metaplasia or heterotopia

AA Sequence

MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCC      1 - 70
FSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQ     71 - 140
NRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVII    141 - 210
LMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVS    211 - 280
NAAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPA    281 - 350
VPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGA    351 - 420
APMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNE    421 - 490
GEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIEN    491 - 560
IYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKES    561 - 630
GLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD                     631 - 683
//

Text Mined References (38)

PMID Year Title
25356045 2014 Modulating effects of acyl-CoA synthetase 5-derived mitochondrial Wnt2B palmitoylation on intestinal Wnt activity.
24770931 2014 TP53 status regulates ACSL5-induced expression of mitochondrial mortalin in enterocytes and colorectal adenocarcinomas.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222123 2013 Differential expression and prognostic role of selected genes in colorectal cancer patients.
23348389 2013 Levels of acyl-coenzyme A synthetase 5 in urothelial cells and corresponding neoplasias reflect cellular differentiation.
22171129 2011 Human intestinal acyl-CoA synthetase 5 is sensitive to the inhibitor triacsin C.
22163040 2011 High ACSL5 transcript levels associate with systemic lupus erythematosus and apoptosis in Jurkat T lymphocytes and peripheral blood cells.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20470896 2010 Lipid-induced up-regulation of human acyl-CoA synthetase 5 promotes hepatocellular apoptosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19459852 2009 Acyl-CoA synthetase as a cancer survival factor: its inhibition enhances the efficacy of etoposide.
19218499 2009 Functional characterization of a promoter polymorphism that drives ACSL5 gene expression in skeletal muscle and associates with diet-induced weight loss.
18806831 2009 Promotion of glioma cell survival by acyl-CoA synthetase 5 under extracellular acidosis conditions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18228202 2008 Expression of acyl-CoA synthetase 5 in human epidermis.
17761945 2007 Transcriptional activation of hepatic ACSL3 and ACSL5 by oncostatin m reduces hypertriglyceridemia through enhanced beta-oxidation.
17681178 2007 Regulation of enterocyte apoptosis by acyl-CoA synthetase 5 splicing.
17495181 2007 Peroxisome proliferator-activated receptor gamma 2 and acyl-CoA synthetase 5 polymorphisms influence diet response.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16198472 2005 Long chain fatty acyl-CoA synthetase 5 expression is induced by insulin and glucose: involvement of sterol regulatory element-binding protein-1c.
15809837 2006 Coeliac disease is associated with impaired expression of acyl-CoA-synthetase 5.
15736044 2005 Characterization of metaplastic and heterotopic epithelia in the human gastrointestinal tract by the expression pattern of acyl-CoA synthetase 5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292367 2004 Revised nomenclature for the mammalian long-chain acyl-CoA synthetase gene family.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14608540 2003 Impaired expression of acyl-CoA-synthetase 5 in epithelial tumors of the small intestine.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12147264 2002 Rat liver acyl-CoA synthetase 4 is a peripheral-membrane protein located in two distinct subcellular organelles, peroxisomes, and mitochondrial-associated membrane.
11707336 2001 Genomic organization and transcription units of the human acyl-CoA synthetase 3 gene.
11319232 2001 Acyl-CoA synthetase isoforms 1, 4, and 5 are present in different subcellular membranes in rat liver and can be inhibited independently.
11127823 2000 Fatty acid induced glioma cell growth is mediated by the acyl-CoA synthetase 5 gene located on chromosome 10q25.1-q25.2, a region frequently deleted in malignant gliomas.
8944226 1996 Biosynthesis of triacylglycerols.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.