Property Summary

NCBI Gene PubMed Count 51
PubMed Score 83.88
PubTator Score 61.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count
Amme Complex 3

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.222 7.7e-04
active ulcerative colitis 1.480 1.2e-02
acute quadriplegic myopathy 1.549 1.4e-06
aldosterone-producing adenoma -1.387 2.3e-02
astrocytoma -1.100 8.8e-16
atypical teratoid / rhabdoid tumor -2.000 1.0e-03
Breast cancer -1.400 6.1e-08
colon cancer 1.100 1.8e-02
cystic fibrosis 1.200 1.1e-02
diabetes mellitus -1.400 1.6e-02
glioblastoma multiforme -1.100 2.0e-18
interstitial cystitis 1.700 4.4e-03
invasive ductal carcinoma -1.200 1.4e-03
lung cancer -1.800 6.5e-04
ovarian cancer -1.200 1.3e-02
tuberculosis -1.400 1.9e-04

Gene RIF (36)

AA Sequence

MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAV      1 - 70
IDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGS     71 - 140
GLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLES    141 - 210
KLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSG    211 - 280
STGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSD    281 - 350
QSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC    351 - 420
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGA    421 - 490
PLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFH    491 - 560
PDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQK    561 - 630
GVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHY    631 - 700
LKDIERMYGGK                                                               701 - 711
//

Text Mined References (57)

PMID Year Title