Property Summary

NCBI Gene PubMed Count 32
PubMed Score 27.01
PubTator Score 28.89

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (15)

PMID Text
23840832 The prominent expression of ACSL3 in VSMC.
23762027 activation of fatty acid import is linked to the up-regulation of cellular long chain acyl-CoA synthetase activity and identify the long chain acyl-CoA syntheatse3 (Acsl3) as a novel host factor required for polio replication.
23125841 Tandem affinity purification and mass spectrometry analysis identify acyl-CoA synthetase long-chain family member 3 (ACSL3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22357706 role of N-terminal region of acyl-CoA synthetase 3 in its function and localization on lipid droplets
22190034 Tandem affinity purification and mass spectrometry analysis identify acyl-CoA synthetase long-chain family member 3 (ACSL3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21328461 expression of ACSL3 was induced by endoplasmic reticulum stress
20605918 Results suggest that initiation of Golgi export of Lyn involves association of ACSL3 with the Lyn C-lobe, which is exposed to the molecular surface in an open conformation.
20308079 ACSL3 is a novel molecular target of PPARdelta in HepG2 cells; there is a regulatory mechanism for ACSL3 transcription in liver tissue
20219900 Results suggest that liver X receptors play a regulatory role in fatty acid metabolism by direct regulation of ACSL3 in human placental trophoblast cells.
19221603 Data suggest that methylated ACSL3 5'CpG islands in umbilical cord white blood cell DNA may be a surrogate endpoint for transplacental polycyclic aromatic hydrocarbon exposure and/or a potential biomarker for environmentally-related asthma.
18003621 Small interfering RNA targeting ACSL3 inhibits secretion of hepatitis c virus from human hepatoma-derived cells
17901542 Data suggest that endogenous FATP4 does not function to translocate fatty acids across the plasma membrane, but functions more as a very long-chain acyl-CoA synthetase.
17761945 Oncostatin M directly lowers the plasma triglycerides in hyperlipidemia by stimulating the transcription of ACSL3/5 in the liver.
15556626 Repression of FAS mRNA expression is the consequence of feedback inhibition of FAS expression by long chain fatty acyl-CoAs, which are formed by FACL3 during its upregulation by vitamin D3in prostate cancer cells.
11707336 Sequence analysis of genomic clones demonstrates that the human ACS3 gene spans at least 80.6 kb and contains 17 exons.

AA Sequence

MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPVNSKPDSAYRS      1 - 70
VNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDV     71 - 140
FVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNI    141 - 210
ITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSD    211 - 280
IAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIG    281 - 350
YSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQI    351 - 420
SKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVW    421 - 490
DYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWL    491 - 560
CTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQK    561 - 630
ELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL    631 - 700
KRKELKTHYQADIERMYGRK                                                      701 - 720
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23840832 2013 Palmitic acid induces osteoblastic differentiation in vascular smooth muscle cells through ACSL3 and NF-?B, novel targets of eicosapentaenoic acid.
23762027 2013 Increased long chain acyl-Coa synthetase activity and fatty acid import is linked to membrane synthesis for development of picornavirus replication organelles.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22357706 2012 The N-terminal region of acyl-CoA synthetase 3 is essential for both the localization on lipid droplets and the function in fatty acid uptake.
21498505 2011 Human lysophosphatidylcholine acyltransferases 1 and 2 are located in lipid droplets where they catalyze the formation of phosphatidylcholine.
21328461 2011 ACSL3 and GSK-3? are essential for lipid upregulation induced by endoplasmic reticulum stress in liver cells.
21269460 2011 Initial characterization of the human central proteome.
20605918 2010 The Lyn kinase C-lobe mediates Golgi export of Lyn through conformation-dependent ACSL3 association.
20308079 2010 Long chain acyl-CoA synthetase-3 is a molecular target for peroxisome proliferator-activated receptor delta in HepG2 hepatoma cells.
20219900 2010 Activation of LXR increases acyl-CoA synthetase activity through direct regulation of ACSL3 in human placental trophoblast cells.
19946888 2010 Defining the membrane proteome of NK cells.
19221603 2009 Relation of DNA methylation of 5'-CpG island of ACSL3 to transplacental exposure to airborne polycyclic aromatic hydrocarbons and childhood asthma.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18003621 2008 Long chain acyl-CoA synthetase 3-mediated phosphatidylcholine synthesis is required for assembly of very low density lipoproteins in human hepatoma Huh7 cells.
17901542 2007 The fatty acid transport protein (FATP) family: very long chain acyl-CoA synthetases or solute carriers?
17761945 2007 Transcriptional activation of hepatic ACSL3 and ACSL5 by oncostatin m reduces hypertriglyceridemia through enhanced beta-oxidation.
17379924 2007 Involvement of ACSL in local synthesis of neutral lipids in cytoplasmic lipid droplets in human hepatocyte HuH7.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
16354793 2006 UTP14c is a recently acquired retrogene associated with spermatogenesis and fertility in man.
15556626 2004 Vitamin D3 inhibits fatty acid synthase expression by stimulating the expression of long-chain fatty-acid-CoA ligase 3 in prostate cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15292367 2004 Revised nomenclature for the mammalian long-chain acyl-CoA synthetase gene family.
14741744 2004 Identification of major proteins in the lipid droplet-enriched fraction isolated from the human hepatocyte cell line HuH7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707336 2001 Genomic organization and transcription units of the human acyl-CoA synthetase 3 gene.
9177793 1997 Human acyl-coenzyme A synthetase 3 cDNA and localization of its gene (ACS3) to chromosome band 2q34-q35.
8944226 1996 Biosynthesis of triacylglycerols.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8663269 1996 Molecular characterization and expression of rat acyl-CoA synthetase 3.
7987323 1994 Localization of the genetic locus for Saethre-Chotzen syndrome to a 6 cM region of chromosome 7 using four cases with apparently balanced translocations at 7p21.2.
6240978 1984 Acyl-CoA synthetase and the peroxisomal enzymes of beta-oxidation in human liver. Quantitative analysis of their subcellular localization.
1848073 1991 Identity between palmitoyl-CoA synthetase and arachidonoyl-CoA synthetase in human platelet?
1433226 1992 The mapping of a gene for craniosynostosis: evidence for linkage of the Saethre-Chotzen syndrome to distal chromosome 7p.