Property Summary

NCBI Gene PubMed Count 36
PubMed Score 388.53
PubTator Score 97.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 2.575 6.5e-03
active ulcerative colitis 1.451 4.9e-02
Atopic dermatitis -1.300 7.6e-04
cystic fibrosis 1.030 3.2e-05
Down syndrome 1.200 1.2e-02
ductal carcinoma in situ -2.500 9.4e-04
glioblastoma 2.100 1.1e-02
invasive ductal carcinoma 1.274 2.0e-02
lung cancer -2.000 1.6e-04
malignant mesothelioma -2.700 1.2e-08
mucosa-associated lymphoid tissue lympho... 1.234 6.9e-03
non primary Sjogren syndrome sicca 1.200 3.0e-02
ovarian cancer -2.600 7.8e-07
pancreatic cancer 1.200 3.8e-02
pancreatic ductal adenocarcinoma liver m... -2.774 1.4e-02
progressive supranuclear palsy -1.200 1.8e-02
Rheumatoid arthritis 1.600 1.2e-02
tuberculosis -1.100 2.4e-02

 GWAS Trait (1)

Gene RIF (15)

AA Sequence

MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGA      1 - 70
RRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQK     71 - 140
GFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLL    141 - 210
EGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTT    211 - 280
GNPKGAMVTHRNIVSDCSAFVKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRL    281 - 350
LMDDLKVLQPTVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKV    351 - 420
QSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHVGAPMPCNLIK    421 - 490
LVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIF    491 - 560
KLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDV    561 - 630
KKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV      631 - 698
//

Text Mined References (40)

PMID Year Title