Property Summary

NCBI Gene PubMed Count 33
PubMed Score 365.58
PubTator Score 97.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.600 1.2e-02
malignant mesothelioma -3.200 1.8e-08
cystic fibrosis 1.030 3.2e-05
glioblastoma 2.100 1.1e-02
Atopic dermatitis -1.300 7.6e-04
tuberculosis and treatment for 3 months -1.400 2.0e-03
pancreatic ductal adenocarcinoma liver m... -4.381 7.7e-04
lung cancer -2.700 8.5e-04
active Crohn's disease 2.575 6.5e-03
ulcerative colitis 1.500 1.7e-02
non primary Sjogren syndrome sicca 1.200 3.0e-02
invasive ductal carcinoma -2.200 3.0e-03
progressive supranuclear palsy -1.200 1.8e-02
mucosa-associated lymphoid tissue lympho... 1.234 6.9e-03
ductal carcinoma in situ -2.800 1.3e-03
ovarian cancer -2.600 7.8e-07
Down syndrome 1.200 1.2e-02
pancreatic cancer 1.200 3.8e-02

Protein-protein Interaction (3)

Gene RIF (12)

PMID Text
26728456 SRE motif in ACSL1 is essential for SREBP2-mediated activation of C-ACSL1 gene transcription.
25915184 ACSL1 is a programmable mediator of insulin sensitivity and cellular lipid content.
24503477 the cell surface protein CD36/FAT directly facilitates fatty acid transport across the plasma membrane, whereas the intracellular acyl-CoA synthetases FATP4 and ACSL1 enhance fatty acid uptake indirectly by metabolic trapping
24462768 Data indicate that expression of miR-205 is negatively related to that of ACSL1 in clinical hepatocellular carcinoma (HCC) tissues.
23433401 long-chain acyl-CoA synthetase 1 has a role in eicosapentaenoic acid suppression of palmitate-induced cytokine production
23303383 INSR rs1366600, ACSL1 rs2292899 and FABP2 rs11724758 could influence the susceptibility to type 2 diabetes in Chinese Han population, most likely through their effects on the specific miRNA-binding sites.
22829935 Findings suggest that the ACSL1 gene polymorphism rs6552828 is not associated with elite endurance athletic status in Caucasians, yet a marginal association seems to exist for the Chinese (Han) male population.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20176858 Data show that ACSL1 rs9997745 polymorphism influences metabolic syndrome risk, most likely via disturbances in fatty acid metabolism, which was modulated by dietary fat consumption, particularly PUFA intake, suggesting novel gene-nutrient interactions.
20176858 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
16834775 Based on homology, two new isoforms for ACSL1 were predicted and characterized, one represented a switch of the Phe- to the Tyr-Gate domain motif, the other resulted from the exclusion of both.

AA Sequence

MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGA      1 - 70
RRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQK     71 - 140
GFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLL    141 - 210
EGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTT    211 - 280
GNPKGAMVTHRNIVSDCSAFVKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRL    281 - 350
LMDDLKVLQPTVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKV    351 - 420
QSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHVGAPMPCNLIK    421 - 490
LVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIF    491 - 560
KLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDV    561 - 630
KKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV      631 - 698
//

Text Mined References (37)

PMID Year Title
26728456 2016 SREBP2 Activation Induces Hepatic Long-chain Acyl-CoA Synthetase 1 (ACSL1) Expression in Vivo and in Vitro through a Sterol Regulatory Element (SRE) Motif of the ACSL1 C-promoter.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915184 2015 ACSL1 Is Associated With Fetal Programming of Insulin Sensitivity and Cellular Lipid Content.
24503477 2014 Protein mediated fatty acid uptake: synergy between CD36/FAT-facilitated transport and acyl-CoA synthetase-driven metabolism.
24462768 2014 MiR-205 modulates abnormal lipid metabolism of hepatoma cells via targeting acyl-CoA synthetase long-chain family member 1 (ACSL1) mRNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23433401 2013 Eicosapentaenoic acid suppresses palmitate-induced cytokine production by modulating long-chain acyl-CoA synthetase 1 expression in human THP-1 macrophages.
23303383 2013 Single-nucleotide polymorphisms inside microRNA target sites influence the susceptibility to type 2 diabetes.
22829935 2012 Acyl coenzyme A synthetase long-chain 1 (ACSL1) gene polymorphism (rs6552828) and elite endurance athletic status: a replication study.
22022213 2011 Overexpression of CD36 and acyl-CoA synthetases FATP2, FATP4 and ACSL1 increases fatty acid uptake in human hepatoma cells.
21269460 2011 Initial characterization of the human central proteome.
21242590 2011 Long-chain acyl-CoA synthetase 4 modulates prostaglandin E? release from human arterial smooth muscle cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20176858 2010 Gene-nutrient interactions with dietary fat modulate the association between genetic variation of the ACSL1 gene and metabolic syndrome.
19946888 2010 Defining the membrane proteome of NK cells.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
16834775 2006 Multiple erythroid isoforms of human long-chain acyl-CoA synthetases are produced by switch of the fatty acid gate domains.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292367 2004 Revised nomenclature for the mammalian long-chain acyl-CoA synthetase gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10548543 1999 Identification and molecular characterization of acyl-CoA synthetase in human erythrocytes and erythroid precursors.
8944226 1996 Biosynthesis of triacylglycerols.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8584017 1995 Molecular cloning and sequencing of human palmitoyl-CoA ligase and its tissue specific expression.
8399326 1993 Purification of peroxisomes and subcellular distribution of enzyme activities for activation and oxidation of very-long-chain fatty acids in rat brain.
7948012 1994 Activation of alkylthioacrylic acids in subcellular fractions of rat tissues: a new spectrophotometric method for assay of acyl-CoA synthetase.
7490105 1995 The human palmitoyl-CoA ligase (FACL2) gene maps to the chromosome 4q34-q35 region by fluorescence in situ hybridization (FISH) and somatic cell hybrid panels.
7429333 1980 Studies on long chain fatty acid:CoA ligase from human small intestine.
2973813 1988 Acyl-CoA ligases from rat brain microsomes: an immunochemical study.
2341402 1990 Structure and regulation of rat long-chain acyl-CoA synthetase.
2007410 1991 Long-chain-acyl-CoA synthetase and very-long-chain-acyl-CoA synthetase activities in peroxisomes and microsomes from rat liver. An enzymological study.
1607358 1992 Human long-chain acyl-CoA synthetase: structure and chromosomal location.
1599407 1992 Subcellular distribution and characteristics of ciprofibroyl-CoA synthetase in rat liver. Its possible identity with long-chain acyl-CoA synthetase.
1531127 1992 Chromosomal localization of the human gene for palmitoyl-CoA ligase (FACL1).