Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.39
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.799 2.2e-03
active ulcerative colitis -1.873 2.7e-03
adrenocortical carcinoma -1.338 3.0e-04
group 3 medulloblastoma -1.200 4.1e-03
interstitial cystitis -1.300 5.6e-03
lung carcinoma -1.700 5.0e-35
malignant mesothelioma -1.600 6.3e-06
medulloblastoma, large-cell -1.100 1.6e-03
nephrosclerosis -1.762 5.6e-03
psoriasis -1.400 2.5e-09

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSYVQGCTKKHLN      1 - 70
SKTVGQCLETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLM     71 - 140
QLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENAQPGALKSQRL    141 - 210
PDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQFLSCHDPINIQFTSGTTGSPKGATLSHYNI    211 - 280
VNNSNILGERLKLHEKTPEQLRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERG    281 - 350
TFLYGTPTMFVDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAH    351 - 420
FPEDTVEQKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYW    421 - 490
TGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDRMGEEICACIRLKD    491 - 560
GEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKIQKFKLREQMERHLNL                   561 - 615
//

Text Mined References (14)

PMID Year Title