Property Summary

NCBI Gene PubMed Count 15
PubMed Score 206.28
PubTator Score 150.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
pancreatic cancer 1.500 1.2e-03
psoriasis -2.800 9.5e-43
osteosarcoma -2.521 2.1e-05
ependymoma -2.900 2.5e-09
glioblastoma -2.100 3.9e-04
sonic hedgehog group medulloblastoma -4.400 5.6e-11
atypical teratoid / rhabdoid tumor -3.600 2.7e-05
medulloblastoma, large-cell -4.100 4.2e-07
primitive neuroectodermal tumor -2.700 1.8e-03
Atopic dermatitis -1.600 4.9e-02
adrenocortical carcinoma -1.978 5.7e-05
pediatric high grade glioma -2.000 1.7e-05
pilocytic astrocytoma -1.600 5.6e-05
pancreatic carcinoma 1.500 1.2e-03
nasopharyngeal carcinoma -1.100 2.5e-06
Down syndrome 1.100 1.4e-02
chronic rhinosinusitis -1.088 4.1e-02

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
15800013 expression tends to be correlated with the severity of X-linked adrenoleukodystrophy

AA Sequence

MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELSVPEKVN      1 - 70
NAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYL     71 - 140
LARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMV    141 - 210
DTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV    211 - 280
YTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCF    281 - 350
AEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL    351 - 420
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYN    421 - 490
YRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFL    491 - 560
YITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTE    561 - 630
QAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTM    631 - 700
KLKRLTVLEKYKGIIDSFYQEQKM                                                  701 - 724
//

Text Mined References (18)

PMID Year Title
20691247 2010 A genome-wide association study of Cloninger's temperament scales: implications for the evolutionary genetics of personality.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16371355 2006 The second member of the human and murine bubblegum family is a testis- and brainstem-specific acyl-CoA synthetase.
15800013 2005 Decreased expression of ABCD4 and BG1 genes early in the pathogenesis of X-linked adrenoleukodystrophy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464426 X-linked adrenoleukodystrophy: role of very long-chain acyl-CoA synthetases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14516277 2004 Murine bubblegum orthologue is a microsomal very long-chain acyl-CoA synthetase.
12975357 2003 The acyl-CoA synthetase "bubblegum" (lipidosin): further characterization and role in neuronal fatty acid beta-oxidation..
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11112418 2000 Novel acyl-CoA synthetase in adrenoleukodystrophy target tissues.
10954726 2000 Very long-chain acyl-CoA synthetases. Human "bubblegum" represents a new family of proteins capable of activating very long-chain fatty acids.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.