Property Summary

NCBI Gene PubMed Count 13
PubMed Score 194.81
PubTator Score 110.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 4.0e-03
lung cancer 1.100 7.7e-04
malignant mesothelioma 1.300 2.9e-04
osteosarcoma 1.469 1.1e-04
ovarian cancer 1.300 3.6e-09
psoriasis 1.200 1.7e-03

Gene RIF (1)

AA Sequence

MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGS      1 - 70
SEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPS     71 - 140
DEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCI    141 - 210
TQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI                   211 - 265
//

Text Mined References (13)

PMID Year Title