Property Summary

NCBI Gene PubMed Count 83
PubMed Score 246.69
PubTator Score 893.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
ovarian cancer 8491 4.3e-07
tuberculosis 1563 4.5e-06
psoriasis 6685 2.0e-05
osteosarcoma 7933 5.2e-05
lung cancer 4473 1.1e-03
active Crohn's disease 918 1.8e-03
active ulcerative colitis 477 6.6e-03
spina bifida 1064 2.7e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.393 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 3.100 2.0e-05
osteosarcoma -2.267 5.2e-05
tuberculosis 2.100 4.5e-06
lung cancer -1.200 1.1e-03
active Crohn's disease 1.811 1.8e-03
active ulcerative colitis 1.648 6.6e-03
spina bifida -1.145 2.7e-02
ovarian cancer -2.400 4.3e-07

Gene RIF (39)

PMID Text
26419820 Prostatic acid phosphatase delays prostate cancer cell growth in G1 phase of the cell cycle.
25740984 Certain factors identified within semen, termed semen-derived enhancers of virus infection (SEVI), fragments of prostatic acid phosphatase, have been shown to significantly enhance HIV-1 infectivity.
24854630 GCNT1 is over-expressed in prostate cancer and is associated with higher levels of core 2 O-sLe(x) in PSA, PAP and MUC1 proteins.
24829029 ACPP increases significantly in epithelial cells of ovarian carcinoma, which indicates that it may be a candidate biomarker for diagnosis of epithelia-derived ovarian cancer in women.
24434023 Data indicate that hypoxia regulates prostatic acid phosphatase (PAP) through hypoxia-inducible factor 2 alpha (HIF2alpha) and from stimulated A2B adenosine receptors.
24338683 Data indicate that prostate acid phosphatase-based peptide vaccine PAP-114-128 peptide appears to be a relevant for the treatment of prostate cancer.
23897810 Soluble ecto-5'-nucleotidase (5'-NT), alkaline phosphatase, and adenosine deaminase (ADA1) activities in neonatal blood favor elevated extracellular adenosine.
23698773 Studies suggest that understanding of prostatic acid phosphatase function and regulation of expression will have a significant impact on understanding prostate cancer (PCa) progression and therapy.
23314347 PAPf39 is a 39 residue peptide fragment from human prostatic acidic phosphatase. Recombinant PAPf39 showed amyloid fibril formation.
22354963 in the in vivo environment, PAP(248-286) is likely to form fibrils efficiently, thus providing an explanation for the presence of semen-derived enhancer of viral infection in human semen.
22090109 Peptide fragments derived from N-proximal and C-proximal of the PAP form fibrillar structures and increase virion attachment to cells.
22082367 PAP is strongly expressed in prostate cancer bone metastases in 7/7 patients, while prostate-specific antigen (PSA) is only weakly expressed.
21487525 Our studies confirmed that, while prostatic acid phosphatase expression is not restricted to prostate tissues, its expression in other human tissues is approximately 1-2 orders of magnitude less than that observed in the prostate.
20645695 Most of the features of PAP including gene regulation, gene/protein structure, functions, its role in tumor progression and evolutionary features are discussed. Review.
20498373 prostatic acid phosphatase, an authentic tyrosine phosphatase, dephosphorylates ErbB-2 and regulates prostate cancer cell growth
20392611 Data show that prostatic acid phosphatase(PAP) as a sensitive tumor marker for prostate cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19902966 molecular details of PAPf39 peptide fibril formation may aid in elucidating the mechanism of how PAPf39 fibrils are involved in HIV etiology
19759923 The obtained N-terminal amino-acid sequence of boar PTAP showed 92% identity with the N-terminal amino-acid sequence of human PAP. The determined sequence of a 354 bp nucleotide fragment showed 90% identity with the corresponding sequence of human PAP.
19636017 Report safety and immunological efficacy of a DNA vaccine encoding prostatic acid phosphatase in patients with stage D0 prostate cancer.
19403677 Prostatic acid phosphatase boosts the infectivity of xenotropic murine leukemia virus-related virus.
19301031 PSAP might be predictive of tumor stage in incidental prostate cancer and represent a valuable adjunct for clinical decisions in terms of individual therapeutic management.
19108401 presence of Prostatic Acid Phosphatase in breast cyst fluid may suggest its possible role in the development of breast cancer from cystic breast diseases
18940592 Suppresses pain by functioning as an ecto-5'-nucleotidase, activating A1-adenosine receptors in the dorsal spinal cord.
17638863 Prostatic acid phosphatase is not a prostate specific target
17455230 PAP (133-152) and PAP (173-192) were immunogenic and processed from whole PAP in HLA-DRB1*1501 tg mice. These peptides were capable of stimulating CD4 T lymphocytes from HLA-DRB1*1501-positive patients with granulomatous prostatitis and normal donors.
16076555 1,25D-mediated decreases in prostate cancer cells and C81 LN cell growth are in part due to decreases in tyrosine kinase signaling that result from up-regulation of cellular prostatic acid phosphatase.
16004602 JFC1 differentially regulates the secretion of PSAP and PSA, and Rab27a and PI3K play a central role in the exocytosis of prostate-specific markers.
15985366 the GAAAATATGATA-like elements are involved in the transcriptional regulation of hPAP promoter constructs in prostatic cells.
15578709 analysis of prostatic acid phosphatase binding
15280042 Prostatic acid phosphatase inactivates lysophosphatidic acid in seminal plasma.
15240830 Transcriptional activation of the prostatic acid phosphatase gene by NF-kappaB in human prostate cancer cells.
14690244 protein binding with Con A in seminal plasma
14623260 Human prostatic acid phosphatase's regulatory regions were analyzed in transgenic mice and cell line transfections, in order to clarify the mechanisms of tissue-specific gene expression
12962324 In dilute solutions, several active prostatic acid phosphatase species exist, which are involved in concentration-dependent dissociation/association equilibria
12719131 equilibrium unfolding of dimeric human prostatic acid phosphatase involves an inactive monomeric intermediate
12362977 analysis of mRNA levels in hyperplastic prostate stimulated with steroid hormones and growth factors
12032838 Identification and characterization of regulatory elements of the human prostatic acid phosphatase promoter.
11833784 Effect of tartaric acid on conformation and stability of human prostatic phosphatase: an infrared spectroscopic and calorimetric study.

AA Sequence

MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQL      1 - 70
TQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQP     71 - 140
IPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVY    141 - 210
DPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSY    211 - 280
KKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPS    281 - 350
CPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTD                                      351 - 386
//

Text Mined References (91)

PMID Year Title
26419820 2016 Transmembrane prostatic acid phosphatase (TMPAP) delays cells in G1 phase of the cell cycle.
25740984 2015 Characterization of the Influence of Semen-Derived Enhancer of Virus Infection on the Interaction of HIV-1 with Female Reproductive Tract Tissues.
24854630 2014 Increased expression of GCNT1 is associated with altered O-glycosylation of PSA, PAP, and MUC1 in human prostate cancers.
24829029 2014 Avian prostatic acid phosphatase: estrogen regulation in the oviduct and epithelial cell-derived ovarian carcinomas.
24657436 2014 Peptides derived from HIV-1 gp120 co-receptor binding domain form amyloid fibrils and enhance HIV-1 infection.
24434023 2014 The HIF-2alpha dependent induction of PAP and adenosine synthesis regulates glioblastoma stem cell function through the A2B adenosine receptor.
24338683 2014 Novel prostate acid phosphatase-based peptide vaccination strategy induces antigen-specific T-cell responses and limits tumour growth in mice.
23897810 2013 Soluble ecto-5'-nucleotidase (5'-NT), alkaline phosphatase, and adenosine deaminase (ADA1) activities in neonatal blood favor elevated extracellular adenosine.
23698773 2013 Human prostatic acid phosphatase: structure, function and regulation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23314347 2013 Bacterial expression and purification of the amyloidogenic peptide PAPf39 for multidimensional NMR spectroscopy.
22389722 2012 Secretion and N-linked glycosylation are required for prostatic acid phosphatase catalytic and antinociceptive activity.
22354963 2012 Seminal plasma accelerates semen-derived enhancer of viral infection (SEVI) fibril formation by the prostatic acid phosphatase (PAP248-286) peptide.
22090109 2012 Naturally occurring fragments from two distinct regions of the prostatic acid phosphatase form amyloidogenic enhancers of HIV infection.
22082367 2011 Prostatic acid phosphatase is expressed in human prostate cancer bone metastases and promotes osteoblast differentiation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21487525 2011 Prostatic acid phosphatase expression in human tissues.
20645695 2010 Structural and functional analysis of human prostatic acid phosphatase.
20498373 2010 Human prostatic acid phosphatase, an authentic tyrosine phosphatase, dephosphorylates ErbB-2 and regulates prostate cancer cell growth.
20392611 2010 Protein complexes/aggregates as potential cancer biomarkers revealed by a nanoparticle aggregation immunoassay.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19995078 2009 NMR structure in a membrane environment reveals putative amyloidogenic regions of the SEVI precursor peptide PAP(248-286).
19902966 2009 Mechanism of fibril formation by a 39-residue peptide (PAPf39) from human prostatic acidic phosphatase.
19897482 2010 Aminoquinoline surfen inhibits the action of SEVI (semen-derived enhancer of viral infection).
19759923 2009 High sequence homology between protein tyrosine acid phosphatase from boar seminal vesicles and human prostatic acid phosphatase.
19636017 2009 Safety and immunological efficacy of a DNA vaccine encoding prostatic acid phosphatase in patients with stage D0 prostate cancer.
19451623 2009 The main green tea polyphenol epigallocatechin-3-gallate counteracts semen-mediated enhancement of HIV infection.
19403677 2009 Fibrils of prostatic acid phosphatase fragments boost infections with XMRV (xenotropic murine leukemia virus-related virus), a human retrovirus associated with prostate cancer.
19301031 2009 Expression of prostatic acid phosphatase (PSAP) in transurethral resection specimens of the prostate is predictive of histopathologic tumor stage in subsequent radical prostatectomies.
19108401 2007 Prostatic acid phosphatase in breast cyst fluid.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18940592 2008 Prostatic acid phosphatase is an ectonucleotidase and suppresses pain by generating adenosine.
18083097 2007 Semen-derived amyloid fibrils drastically enhance HIV infection.
17897319 2007 Integral and associated lysosomal membrane proteins.
17658863 2007 Single-walled carbon nanotubes exhibit strong antimicrobial activity.
17638863 2007 Prostatic acid phosphatase is not a prostate specific target.
17455230 2007 Identification of HLA-DRB1*1501-restricted T-cell epitopes from human prostatic acid phosphatase.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16076555 2005 Vitamin D receptor agonists induce prostatic acid phosphatase to reduce cell growth and HER-2 signaling in LNCaP-derived human prostate cancer cells.
16004602 2005 The Rab27a-binding protein, JFC1, regulates androgen-dependent secretion of prostate-specific antigen and prostatic-specific acid phosphatase.
15985366 2005 GAAAATATGATA-like elements in androgen-associated regulation of the prostatic acid phosphatase gene.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15578709 2005 Theoretical investigations of prostatic acid phosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280042 2004 Prostatic acid phosphatase degrades lysophosphatidic acid in seminal plasma.
15240830 2004 Transcriptional activation of the human prostatic acid phosphatase gene by NF-kappaB via a novel hexanucleotide-binding site.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690244 2003 Identification of gp17 glycoprotein and characterization of prostatic acid phosphatase (PAP) and carboxypeptidase E (CPE) fragments in a human seminal plasma fraction interacting with concanavalin A.
14623260 2003 Tissue-specific expression of the prostatic acid phosphatase promoter constructs.
12962324 2003 Concentration-dependent dissociation/association of human prostatic acid phosphatase.
12719131 2003 Equilibrium unfolding of dimeric human prostatic acid phosphatase involves an inactive monomeric intermediate.
12525165 2003 Crystal structures of human prostatic acid phosphatase in complex with a phosphate ion and alpha-benzylaminobenzylphosphonic acid update the mechanistic picture and offer new insights into inhibitor design.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12362977 2002 Comparative analysis of prostatic acid phosphatase and prostate-specific antigen mRNA levels in hyperplastic prostate stimulated with steroid hormones and growth factors.
11983210 2002 Protection of prostatic acid phosphatase activity in human serum samples by plasmin inhibitors.
11784334 2002 Amidolytic activity of prostatic acid phosphatase on human semenogelins and semenogelin-derived synthetic substrates.
11739538 2001 Dendritic cell-based xenoantigen vaccination for prostate cancer immunotherapy.
11547122 2001 Induction of tumor specific cytotoxic T lymphocytes in prostate cancer using prostatic acid phosphatase derived HLA-A2402 binding peptide.
11377343 2001 Comparison of anti-prostate-specific membrane antigen antibodies and other immunomarkers in metastatic prostate carcinoma.
11067847 2001 Characterization of a prostate-specific tyrosine phosphatase by mutagenesis and expression in human prostate cancer cells.
10851066 2000 Interaction between protein tyrosine phosphatase and protein tyrosine kinase is involved in androgen-promoted growth of human prostate cancer cells.
10639192 2000 Crystal structure of human prostatic acid phosphatase .
10506719 1999 The age of the urologist affects the postoperative care of prostate carcinoma patients.
10477906 1999 In situ hybridization study of PSP94 (prostatic secretory protein of 94 amino acids) expression in human prostates.
10452601 Effects of liver disease and transplantation on the human prostate.
9804805 1998 Structural origins of L(+)-tartrate inhibition of human prostatic acid phosphatase.
9708626 1998 Undetectable serum prostate-specific antigen associated with metastatic prostate cancer: a case report and review of the literature.
9705354 1998 Tyrosine phosphorylation of c-ErbB-2 is regulated by the cellular form of prostatic acid phosphatase in human prostate cancer cells.
9584847 1997 Prostatic acid phosphatase: structural aspects of inhibition by L-(+)-tartrate ions.
9584846 1997 Covalent modification and site-directed mutagenesis of an active site tryptophan of human prostatic acid phosphatase.
9187691 1997 Human glandular kallikrein 2 (hK2) expression in prostatic intraepithelial neoplasia and adenocarcinoma: a novel prostate cancer marker.
8407898 1993 Three-dimensional structure of rat acid phosphatase in complex with L(+)-tartrate.
8244395 1993 The prostatic acid phosphatase (ACPP) gene is localized to human chromosome 3q21-q23.
8132635 1994 Heterologous expression of human prostatic acid phosphatase and site-directed mutagenesis of the enzyme active site.
8110833 1994 Analysis of the promoter of the human prostatic acid phosphatase gene.
8037752 1994 Structural comparison of human and rat prostate-specific acid phosphatase genes and their promoters: identification of putative androgen response elements.
7951074 1994 Nucleotide sequence of human prostatic acid phosphatase ACPP gene, including seven Alu repeats.
7923807 1994 Human prostatic acid phosphatase: selected properties and practical applications.
3674882 1987 Structures of the carbohydrate moieties of human prostatic acid phosphatase elucidated by H1 nuclear magnetic resonance spectroscopy.
2965059 1987 Molecular cloning of cDNA for human prostatic acid phosphatase.
2842184 1988 Molecular cloning and sequence analysis of cDNA encoding human prostatic acid phosphatase.
2712834 1989 Human prostatic acid phosphatase: cDNA cloning, gene mapping and protein sequence homology with lysosomal acid phosphatase.
2411954 1985 The ultrastructural localization of prostatic specific antigen and prostatic acid phosphatase in hyperplastic and neoplastic human prostates.
2395659 1990 Nucleotide sequence of human prostatic acid phosphatase determined from a full-length cDNA clone.
1989985 1991 Covalent structure, disulfide bonding, and identification of reactive surface and active site residues of human prostatic acid phosphatase.
1699876 1990 Extraprostatic localization of prostatic acid phosphatase and prostate-specific antigen: distribution in cloacogenic glandular epithelium and sex-dependent expression in human anal gland.
1696855 1990 Prostatic acid phosphatase in serum of patients with prostatic cancer is a specific phosphotyrosine acid phosphatase.
1375464 1992 Structure of human prostatic acid phosphatase gene.
480493 1979 Combined serum and bone marrow radioimmunoassays for prostatic acid phosphatase.
76687 1978 Radioimmunochemical measurement of bone marrow prostatic acid phosphatase.