Property Summary

Ligand Count 6
NCBI Gene PubMed Count 86
PubMed Score 249.28
PubTator Score 893.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
ovarian cancer 8520 4.3e-07
psoriasis 6694 2.9e-06
tuberculosis 2010 4.5e-06
osteosarcoma 7950 5.2e-05
lung cancer 4740 1.1e-03
active Crohn's disease 922 1.8e-03
active ulcerative colitis 764 6.6e-03
spina bifida 1074 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Choroid Plexus Papilloma 10 3.588 1.8
Cancer 2499 3.404 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease 1.811 1.8e-03
active ulcerative colitis 1.648 6.6e-03
lung cancer -1.200 1.1e-03
osteosarcoma -2.267 5.2e-05
ovarian cancer -2.400 4.3e-07
psoriasis 2.000 2.9e-06
spina bifida -1.145 2.7e-02
tuberculosis 2.100 4.5e-06

Gene RIF (42)

AA Sequence

MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQL      1 - 70
TQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNLAALFPPEGVSIWNPILLWQP     71 - 140
IPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQDLFGIWSKVY    141 - 210
DPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSY    211 - 280
KKLIMYSAHDTTVSGLQMALDVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPS    281 - 350
CPLERFAELVGPVIPQDWSTECMTTNSHQGTEDSTD                                      351 - 386
//

Text Mined References (94)

PMID Year Title