Property Summary

NCBI Gene PubMed Count 72
PubMed Score 1807.39
PubTator Score 80.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.300 2.1e-04
non-small cell lung cancer -1.765 6.9e-17
lung cancer -2.400 3.7e-04
interstitial cystitis 2.100 1.1e-03
lung carcinoma -3.300 3.1e-29
invasive ductal carcinoma 1.200 2.8e-03
ulcerative colitis 1.500 1.7e-04

Protein-protein Interaction (3)

Gene RIF (48)

PMID Text
27089726 Trap-5b is overexpressed in renal cell carcinoma patients with bone metastasis and bone resorption.
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
26427154 Serum levels of NTx and TRACP5b are sensitive and simple biomarkers to indicate aberrant bone metabolism in giant cell tumor of bone, and they may have a clinical significance in GCT diagnosis.
25778334 TRACP5a may be a promising chronic inflammatory marker and may play a prognostic role in cancer cachexia.
23990468 Pax6 binds endogenously to the proximal region of the tartrate acid phosphatase (TRAP) gene promoter and suppresses nuclear factor of activated T cells c1 (NFATc1)-induced TRAP gene expression.
23737138 TRACP5b has limited utility as a single marker of metabolic bone disease treatment.
23604121 Immunohistochemistry revealed that ACP5 expression was positively correlated with FoxM1 expression in human HCC tissues, and their coexpression was associated with poor prognoses
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of acid phosphatase 5, tartrate resistant (ACP5) in peptide-treated PBMCs
22844067 Tartrate-resistant acid phosphatase stain-ing of bone marrow osteoclasts cannot serve as a tool to determine the time of death of a patient.
22517558 The results showed that both OC and TRACP-5b values were at their highest during the ovulation period, and the activity of TRACP-5b was more significant than that of OC. Furthermore, the changes in sex hormone secretion involved in OC and TRACP-5b showed specific patterns during the menstrual cycle.
22490295 The ACP5 gene is neither associated with the occurrence nor the curve severity of adolescent idiopathic scoliosis.
22357739 Data from studies in relatively young, postmenopausal women suggest that serum level of TRAP 5b (a marker of bone resorption) can be lowered by dietary factors (i.e., low-fat vitamin D- and calcium-fortified cheese).
22335021 TRAcP 5b could be useful as a diagnostic tool for the detection of bone metastases in patients with breast cancer.
21386798 TRAP is a novel human adipokine produced by macrophages and secreted from the subcutaneous adipose tissue in vivo and in vitro. TRAP is involved in fat accumulation and adipose inflammation.
21300043 Serum TRACP5a is a macrophage-derived inflammation marker associated with CVD risk
21217755 Tartrate-resistant acid phosphatase deficiency causes a bone dysplasia with autoimmunity and a type I interferon expression signature
21217752 osteopontin is regulated by TRAP in the pathogenesis of common autoimmune disorders
20967488 The presence of TRAP-positive macrophages in bone metastases could, together with cancer cells and osteoclasts, contribute to the elevated levels of serum TRAP activity observed in patients with bone metastases.
20932965 Serum TRACP5b activity test is a potentially useful adjunct in diagnosing and monitoring bone metastasis in non-small cell lung cancer
20416078 TRACP 5b activity and its interval change after treatment bore a prognostic role in breast cancer patients with bone metastasis and a high baseline serum TRACP 5b activity.
19765782 Tartrate-resistant acid phosphatase 5a remained unaffected by exercise training, consistent with our hypothesis that it is associated with increased adipose tissue in obese individuals
19026169 Data showed that serum TRACP5b was a sensitive and useful parameter for the evaluation of age-related changes of bone absorption.
18979172 Data show that tartrate-resistant acid phosphatase activity is modulated during osteoblastic differentiation, possibly in response to the redox state of the cell, since it seemed to depend on suitable levels of reduced glutathione.
18703035 These results indicate that the differences between TRAP 5a and 5b consist not only of a difference in modification by sialic acid but differences in other sugar chain structures.
18421493 Tartrate-resistant acid phosphatase (TRAP) 5b is a new marker of bone resorption that is unaffected by renal dysfunction
18410226 This study was undertaken to examine the significance of serum TRACP isoforms 5a and 5b as disease markers of inflammation and bone destruction in rheumatoid arthritis.
18320034 Over-expression of monomeric tartrate resistant acid phosphatase, but not the dimeric form in adipose tissue leads to early onset spontaneous hyperplastic obesity
18285546 Observational study of gene-disease association. (HuGE Navigator)
18221403 Serum TRACP5b may be a good marker for serum bone resorption in predialysis chronic kidney disease patients, as it is not affected by renal dysfunction.
18053985 Myeloma-osteoclast interactions stimulated the production of TRAP, cathepsin K, MMP-1, -9, and uPA
17997709 heterozygous mutation (R714C) of the osteopetrosis gene, pleckstrin homolog domain containing family M (with run domain) member 1 (PLEKHM1), impairs vesicular acidification and increases TRACP secretion in osteoclasts
17357281 TRAP 5b may serve as a new additional marker of bone resorption in the assessment of renal osteodystrophy.
17088078 This work suggests that tumour derived TRAP contributes to the raised enzyme activity found in the serum of breast cancer patients.
16869970 TRAP might be useful as a marker of progression of malignant disease and could be a potential target for cancer therapies.
16620768 These results suggest that the protease-sensitive loop peptide, redox-active iron, and disulfide bond are important regulatory sites in TRACP.
16280328 the MCP-1-induced TRAP(+)/CTR(+) multinuclear cells represent an arrested stage in osteoclast differentiation, after NFATc1 induction and cellular fusion but prior to the development of bone resorption activity
16200454 The results suggest that in endothelial cells of the afferent arterioles, mesangial cells, and lymphocytes the cellular activities are regulated by high constitutive phosphotyrosine phosphatase.
15993892 crystal structures at 2.2A resolution demonstrate that the repression loop exhibits significant conformational flexibility, and the observed alternate binding mode suggests a possible inhibitory role for this loop (purple Acid phosphatase)
15950921 a role of the loop residue D158 in catalysis in the cleaved enzyme.
15878315 Results lead to hypothesize that the capacity of osteoblast-like cells to endocytose TRACP (ACP5) is important for the removal of this enzyme during or following the bone resorptive activity of the osteoclast.
15701839 Elevated tartrate-resistant acid phosphatase 5b in serum is associted with extensive bone metastasis in breast cancer
15542543 The Human serum tartrate-resistant acid phosphatase exists as two enzyme isoforms (TRACP 5a and 5b), derived by differential, post-translational processing of a common gene product.
12901871 In human serum, TRACP 5b circulates in a large complex that contained alpha2M and calcium.
12845688 Increased tartrate-resistant acid phosphatase isoform 5b is associated with multiple myeloma bone disease
12820342 specific and sensitive marker of bone resorption and for the early detection of the spreading of breast cancer cells to bone
12589973 serum tartrate resistant tartrate resistant acid phosphatase 5 is useful as a marker for bone resorption
12073156 One isoenzyme, but not the other (5b but not 5a) correlates with other markers of bone turnover and bone mineral density.
11983200 Serum tartrate-resistant acid phosphatase isoforms in rheumatoid arthritis.

AA Sequence

MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLG      1 - 70
DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLH     71 - 140
FKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWS    141 - 210
IAEHGPTHCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLR    211 - 280
FHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP                             281 - 325
//

Text Mined References (74)

PMID Year Title
27089726 [TARTRAT-RESISTANT ACID PHOSPHATASE AS BONE'S RESORBTION MARKER IN PATIENTS WITH BONE METASTASES].
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
26427154 2015 Serum Levels of NTx and TRACP5b in Giant Cell Tumor of Bone and its Clinical Implications.
25778334 The correlation between a chronic inflammatory marker Tartrate-resistant acid phosphatase 5a with cancer cachexia.
23990468 2013 The paired-box homeodomain transcription factor Pax6 binds to the upstream region of the TRAP gene promoter and suppresses receptor activator of NF-?B ligand (RANKL)-induced osteoclast differentiation.
23737138 2014 Limited utility of tartrate-resistant acid phosphatase isoform 5b in assessing response to therapy in osteoporosis.
23604121 2014 ACP5, a direct transcriptional target of FoxM1, promotes tumor metastasis and indicates poor prognosis in hepatocellular carcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22844067 2012 Post-mortem analysis of bone marrow osteoclasts using tartrate-resistant acid phosphatase staining: does histochemistry work and correlate with time since death?
22517558 2012 A change of osteocalcin (OC) and tartrate resistant acid phosphatase 5b (TRACP-5b) with the menstrual cycle.
22490295 2012 [Association between tartrate-resistant acid phosphatase 5 gene polymorphism and adolescent idiopathic scoliosis].
22357739 2012 Consumption of vitamin D-and calcium-fortified soft white cheese lowers the biochemical marker of bone resorption TRAP 5b in postmenopausal women at moderate risk of osteoporosis fracture.
22335021 2011 Value of TRAcP 5b as a diagnostic marker for detection of bone metastases in patients with breast cancer.
21386798 2011 Expression and secretion of the novel adipokine tartrate-resistant acid phosphatase from adipose tissues of obese and lean women.
21300043 2011 Serum tartrate-resistant acid phosphatase isoform 5a (TRACP5a) as a potential risk marker in cardiovascular disease.
21217755 2011 Tartrate-resistant acid phosphatase deficiency causes a bone dysplasia with autoimmunity and a type I interferon expression signature.
21217752 2011 Genetic deficiency of tartrate-resistant acid phosphatase associated with skeletal dysplasia, cerebral calcifications and autoimmunity.
20967488 2011 Differential expression of tartrate-resistant acid phosphatase isoforms 5a and 5b by tumor and stromal cells in human metastatic bone disease.
20932965 2011 Serum tartrate-resistant acid phosphatase 5b (TRACP5b) activity as a biomarker for bone metastasis in non-small cell lung cancer patients.
20416078 2010 Serum tartrate-resistant acid phosphatase 5b activity as a prognostic marker of survival in breast cancer with bone metastasis.
19765782 2010 Effects of exercise on insulin sensitivity, inflammatory cytokines, and serum tartrate-resistant acid phosphatase 5a in obese Chinese male adolescents.
19026169 2008 Age-related changes of serum tartrate-resistant acid phosphatase 5b and the relationship with bone mineral density in Chinese women.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18979172 2008 Tartrate-resistant acid phosphatase activity and glutathione levels are modulated during hFOB 1.19 osteoblastic differentiation.
18703035 2008 Tartrate-resistant acid phosphatase 5a and 5b contain distinct sugar moieties.
18421493 2008 Serum levels of TRAP5b, a new bone resorption marker unaffected by renal dysfunction, as a useful marker of cortical bone loss in hemodialysis patients.
18410226 2008 Significance of serum TRACP in rheumatoid arthritis.
18320034 2008 Monomeric tartrate resistant acid phosphatase induces insulin sensitive obesity.
18285546 2008 A PAI-1 (SERPINE1) polymorphism predicts osteonecrosis in children with acute lymphoblastic leukemia: a report from the Children's Oncology Group.
18221403 2008 Utility of serum tartrate-resistant acid phosphatase (TRACP5b) as a bone resorption marker in patients with chronic kidney disease: independence from renal dysfunction.
18053985 2008 Interactions of myeloma cells with osteoclasts promote tumour expansion and bone degradation through activation of a complex signalling network and upregulation of cathepsin K, matrix metalloproteinases (MMPs) and urokinase plasminogen activator (uPA).
17997709 2008 A new heterozygous mutation (R714C) of the osteopetrosis gene, pleckstrin homolog domain containing family M (with run domain) member 1 (PLEKHM1), impairs vesicular acidification and increases TRACP secretion in osteoclasts.
17357281 2006 Tartrate-resistant acid phosphatase 5b and its correlations with other markers of bone metabolism in kidney transplant recipients and dialyzed patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17088078 2007 Human breast cancer cell lines and tissues express tartrate-resistant acid phosphatase (TRAP).
16869970 2006 Increased tartrate-resistant acid phosphatase (TRAP) expression in malignant breast, ovarian and melanoma tissue: an investigational study.
16620768 2006 Effects of proteolysis and reduction on phosphatase and ROS-generating activity of human tartrate-resistant acid phosphatase.
16280328 2006 MCP-1-induced human osteoclast-like cells are tartrate-resistant acid phosphatase, NFATc1, and calcitonin receptor-positive but require receptor activator of NFkappaB ligand for bone resorption.
16200454 2005 Localisation of high acid phosphotyrosine phosphatase activity in afferent arterioles and glomeruli of human kidney.
15993892 2005 Crystal structures of recombinant human purple Acid phosphatase with and without an inhibitory conformation of the repression loop.
15950921 2005 Human tartrate-resistant acid phosphatase becomes an effective ATPase upon proteolytic activation.
15878315 2005 Endogenous expression and endocytosis of tartrate-resistant acid phosphatase (TRACP) by osteoblast-like cells.
15701839 2005 Tartrate-resistant acid phosphatase 5b is a useful serum marker for extensive bone metastasis in breast cancer patients.
15542543 2005 Properties and expression of human tartrate-resistant acid phosphatase isoform 5a by monocyte-derived cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12901871 2003 Tartrate-resistant acid phosphatase 5B circulates in human serum in complex with alpha2-macroglobulin and calcium.
12845688 2003 Tartrate-resistant acid phosphatase isoform 5b: a novel serum marker for monitoring bone disease in multiple myeloma.
12820342 Tartrate-resistant acid phosphatase 5B is a specific and sensitive marker of bone resorption.
12589973 2003 Development of immunoassays for type-5 tartrate-resistant acid phosphatase in human serum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450668 2002 Acid phosphatases as markers of bone metabolism.
12073156 2002 Serum tartrate-resistant acid phosphatase 5b, but not 5a, correlates with other markers of bone turnover and bone mineral density.
12009023 2002 Use of a phage display technique to identify potential osteoblast binding sites within osteoclast lacunae.
10862785 2000 IL-4 gene therapy for collagen arthritis suppresses synovial IL-17 and osteoprotegerin ligand and prevents bone erosion.
10389595 1999 T cell numbers relate to bone involvement in Gaucher disease.
9521821 1998 Studies on the protein tyrosine phosphatase activity of tartrate-resistant acid phosphatase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8449511 1993 Assignment of the mouse tartrate-resistant acid phosphatase gene (Acp5) to chromosome 9.
8359686 1993 Isolation and characterization of the genes encoding mouse and human type-5 acid phosphatase.
8200916 1994 Interleukin 4 increases type 5 acid phosphatase mRNA expression in murine bone marrow macrophages.
8195113 1994 Dephosphorylation of osteopontin and bone sialoprotein by osteoclastic tartrate-resistant acid phosphatase. Modulation of osteoclast adhesion in vitro.
8188227 1994 Confirmation of the assignment of the human tartrate-resistant acid phosphatase gene (ACP5) to chromosome 19.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2909539 1989 Molecular cloning of the type 5, iron-containing, tartrate-resistant acid phosphatase from human placenta.
2808373 1989 Normal rat kidney cells secrete both phosphorylated and nonphosphorylated forms of osteopontin showing different physiological properties.
2775236 1989 Purification and characterization of a tartrate-resistant acid phosphatase from human osteoclastomas.
2610679 1989 Purification and N-terminal sequence of two tartrate-resistant acid phosphatases type-5 from the hairy cell leukemia spleen.
2473026 1989 Localization of the human type 5, tartrate-resistant acid phosphatase gene by in situ hybridization.
2338077 1990 Type 5 acid phosphatase. Sequence, expression and chromosomal localization of a differentiation-associated protein of the human macrophage.
2334436 1990 Purification and N-terminal amino acid sequence of the tartrate-resistant acid phosphatase from human osteoclastoma: evidence for a single structure.
1872798 1991 Tartrate-resistant acid phosphatase from human osteoclastomas is translated as a single polypeptide.
1477968 1992 Heterogeneity of hairy cell tartrate-resistant acid phosphatase.