Property Summary

NCBI Gene PubMed Count 31
PubMed Score 234.27
PubTator Score 37.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.300 2.4e-06
lung cancer 1.300 1.5e-02
non primary Sjogren syndrome sicca 1.100 3.4e-02
ovarian cancer 1.300 1.6e-04

 GO Function (1)

Gene RIF (5)

PMID Text
19064571 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of acid phosphatase 2, lysosomal (ACP2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17357082 Genome-wide association study of gene-disease association. (HuGE Navigator)
15503243 An enzymatically inactive allele of mouse Acp2 causes cerebellum abnormalities, growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype.
9228031 LAP-deficient mice exhibit multiple defects including bone structure alterations, lysosomal storage defects in the kidneys and central nervous system, and an increased tendency towards seizures.

AA Sequence

MAGKRSGWSRAALLQLLLGVNLVVMPPTRARSLRFVTLLYRHGDRSPVKTYPKDPYQEEEWPQGFGQLTK      1 - 70
EGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNGMQRFNPNISWQPIP     71 - 140
VHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVYDTL    141 - 210
FCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQGGVLLAQIRKNLTLMATTSQLPKL    211 - 280
LVYSAHDTTLVALQMALDVYNGEQAPYASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCP    281 - 350
LQDFLRLTEPVVPKDWQQECQLASGPADTEVIVALAVCGSILFLLIVLLLTVLFRMQAQPPGYRHVADGE    351 - 420
DHA                                                                       421 - 423
//

Text Mined References (35)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19946888 2010 Defining the membrane proteome of NK cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17357082 2007 Identification of a novel risk locus for progressive supranuclear palsy by a pooled genomewide scan of 500,288 single-nucleotide polymorphisms.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15503243 2004 Mutation in the gene encoding lysosomal acid phosphatase (Acp2) causes cerebellum and skin malformation in mouse.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11801736 2002 The tyrosine motifs of Lamp 1 and LAP determine their direct and indirect targetting to lysosomes.
9228031 1997 Mice deficient in lysosomal acid phosphatase develop lysosomal storage in the kidney and central nervous system.
9110174 1997 Large-scale concatenation cDNA sequencing.
9040486 1997 Cathepsin G, acid phosphatase, and alpha 1-proteinase inhibitor messenger RNA levels in keratoconus corneas.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7576159 1995 Clinical and biological aspects of acid phosphatase.
6970673 1980 Isoelectric focusing pattern of acid phosphatase and acid esterase in human blood cells, including thymocytes, T lymphocytes, and B lymphocytes.
6651479 1983 Beta-glucuronidase of lymphocytes in ontogenetic development of man.
6193776 1983 Histochemical identification of osteoclasts. Review of current methods and reappraisal of a simple procedure for routine diagnosis on undecalcified human iliac bone biopsies.
6164873 1981 Activation of lysosomal acid phosphatase of eosinophil leukocytes.
5410815 1970 Deficiency of lysosomal acid phosphatase. A new familial metabolic disorder.
4856491 1974 Human acid phosphatase in somatic cell hybrids.
3904632 1985 Biosynthesis and processing of lysosomal acid phosphatase in cultured human cells.
3191910 1988 Human lysosomal acid phosphatase: cloning, expression and chromosomal assignment.
3160696 1985 Synthesis and transport of lysosomal acid phosphatase in normal and I-cell fibroblasts.
3056714 1988 Human lysosomal acid phosphatase is transported as a transmembrane protein to lysosomes in transfected baby hamster kidney cells.
2776754 1989 Structure of the human lysosomal acid phosphatase gene.
2684640 1989 Sequential processing of lysosomal acid phosphatase by a cytoplasmic thiol proteinase and a lysosomal aspartyl proteinase.
975882 1976 Assignment and linear order of human acid phosphatase-2, esterase A4, and lactate dehydrogenase A genes on chromosome 11.
730175 1978 Regional mapping of the gene for human lysosomal acid phosphatase (ACP2) using a hybrid clone panel containing segments of human chromosome 11.
69583 1977 Intracellular enzymatic response of lymphocytes and neutrophils in patients with cancer of the larynx.