Property Summary

NCBI Gene PubMed Count 110
PubMed Score 282.00
PubTator Score 247.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.528 5.3e-04
osteosarcoma 1.372 1.5e-03
non-small cell lung cancer 1.388 5.2e-18
lung cancer 2.200 1.1e-04
group 3 medulloblastoma 1.600 6.7e-03
non primary Sjogren syndrome sicca 1.100 2.0e-02
Alzheimer's disease -1.200 1.7e-02
Pick disease -1.100 4.8e-05
Breast cancer 1.200 2.1e-09
invasive ductal carcinoma 1.700 2.0e-04
ovarian cancer 1.600 4.4e-04

Protein-protein Interaction (3)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
652005 confirmatory 73 / 0 / 265 Dose response confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay
686963 confirmatory 4 / 0 / 13 SAR confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay
743308 confirmatory 17 / 0 / 26 SAR confirmation of small molecule inhibitors of Low Molecular Weight Protein Tyrosine Phosphatase, LMPTP, in an orthogonal absorbance-based assay, set 2

Gene RIF (92)

PMID Text
26386860 Suggest that hypermethylation of ACP1, BMP4, and TSPYL5 are common events in HCC and could be used as potentially detectable biomarkers in HCC tissues.
26216523 ADA6, PTPN22 and ACP1 are involved in immune reactions: since endometriosis has an autoimmune component.
26213100 LMPTP expression increases in end-stage heart failure in humans
25846885 Association of an increased risk of coronary artery disease, especially in females, with ACP1 polymorphisms.
25781955 ACP1 knockdown attenuates effects of osmotic stress in HaCaT cells, mainly in the status of Src kinase, Rac and STAT5 phosphorylation and activity.
25125338 ACP1 polymorphism is associated with type 1 diabetes mellitus.
25123136 The rs3828329 of ACP1 gene is also a risk factor of CAD in Han Chinese females aged 65 years and older.
24933463 the present study found that the ACP1*C allele, previously associated with an increased vulnerability to infectious/parasitic diseases may also be able to shape behavioral immune defenses by interaction with the level of E.
23959645 In Class 3 people the combination of high ACP f-isozyme concentration and the ADA*2 allele, lowers the rate of glycolysis that may reduce the amount of metabolic calories and activates Sirtuin genes that protect cells against age-related diseases.
23645747 mRNA expression of the slow isoform was increased in breast cancer and that of the fast isoform was reduced in breast cancer.
23621699 certain genotypes of ACP1 associated with high phosphatase activity may increase the T-cell response to PF4-heparin complexes, with higher levels of circulating antibodies
23584899 clarification of the importance of ACP1 in carcinogenesis through the analysis of LMW-PTP interaction with different substrates [review]
23453606 A significant increase of PTPN22 *T allele in endometriosis is observed in women carrying ACP1*C allele, in women carrying p53 codon 72 *Pro allele
23278455 In ACP1 *B/*C genotype, which shows the highest enzymatic activity, spermatic concentration is significantly lower and atypical spermatozoa are significantly more frequent as compared to other ACP1 genotypes.
23197232 The data suggest an interaction between p53 codon 72 and ACP wherein a positive effect of the p53 *Pro allele on susceptibility to coronary artery disease occurs.
22854047 balanced redox-state is required for VEGF to facilitate reversible S-glutathionylation of LMW-PTP, FAK activation and endothelial cell migration
22692348 There is a significant association between acid phosphatase locus 1 (ACP(1) and cancer grade, mainly due to ACP(1) genotypes carrying the *C allele that are much less represented in patients with low grade when compared with those with high grade.
22428720 lack of association with inflammatory bowel disease in Spanish patients
22064183 Data indicate that ACP1 rs11553742*T with increased susceptibility in systemic lupus erythematosus (SLE) patients.
22035742 Gain of the telomeric region 2p25.3 harboring the ACP1 gene is common in CLL (25%, 44 of 178 cases).
21767392 the ACP1*C allele influences the risk of cardiovascular disease events in patients with rheumatoid arthritis.
21644204 investigated hypothesis that favism is caused by toxic Vicia faba substances, which in some ACP1 phenotypes cause increased phosphorylation and thus increased glycolysis, with strong reduction in reduced glutathione production, resulting in hemolysis
21538645 Although both variants dephosphorylate the EPHA2 receptor, the rate and specificity of dephosphorylation for specific tyrosines are different for ACP1 and human cytoplasmic protein tyrosine phosphatase-B.
21423239 the ACP1 protein is a tyrosine phosphatase that influences Wnt signaling, a pathway regulated by lithium, making ACP1 a functional candidate for involvement in the phenotype.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20805743 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20805743 Type 1 diabetes subjects show a highly significant increase of ACP1*A/ADA1*2 gametic type compared with healthy subjects from the same population (P = 0.003).
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20581655 association with coronary artery disease evident only in diabetic subjects and dependent on female gender
20581655 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20152999 the correlation between blood glucose and glycated Hb in relation to AK1 and ACP1 polymorphism was studied.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19855922 In overweight women (BMI > 25), the proportion of low activity ACP1 phenotypes is much lower in type 1 diabetes than in gestational diabetes and in healthy females.
19789510 A significant interaction between ACP1 and ADA1 concerning susceptibility to type 1 diabetes, was revealed.
19622628 Variation in ACP1 is associated with fasting insulin and insulin sensitivity in a sex-specific manner. There is a sex-specific effect of variation in ACP1 to alter insulin signaling.
19622628 Observational study of gene-disease association. (HuGE Navigator)
19570551 A possible protective effect of ACP1 genotype against cardiovascular risk factors was observed in this study
19569002 The present data suggest an epistatic action of ACP1 concerning the effect of Hp on the susceptibility to convulsive disorders.
19246900 ACP1 may be involved in susceptibility to coronary artery disease
19246900 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19217450 Present in adipocytes, this protein may have a specific role in the regulation of quantity of adipose tissue.
19217450 Observational study of gene-disease association. (HuGE Navigator)
18992867 High concontration of the ACP1 F isoform may negatively regulate cell proliferation and growth of leiomyomas through dephosphorylation of the PDGF receptor.
18992867 Observational study of gene-disease association. (HuGE Navigator)
18786445 There is an increase of the *B/*B genotype (high F isoform) & a much more marked decrease of genotypes with the high S isoform in colon cancer, compared with controls.
18786445 Observational study of gene-disease association. (HuGE Navigator)
18768081 Highly significant differences in birth weight-placental weight correlations were observed among acid phosphatase locus 1 phenotypes.
18768081 Observational study of gene-disease association. (HuGE Navigator)
18604186 Observational study of gene-disease association. (HuGE Navigator)
18490013 These findings suggest that carriers of high activity ACP1 genotypes are more susceptible to endometriosis but less susceptible to allergic manifestations than carriers of other ACP1 genotypes.
18490013 Observational study of gene-disease association. (HuGE Navigator)
18262048 The increase of fast isozyme concentration increased the invasive capacity of cancer cells, whereas a decrease of slow isozyme concentration in cancer did not cause growth inhibition and so resulted in cancer cell proliferation.
18262048 Observational study of gene-disease association. (HuGE Navigator)
17703100 Observational study of gene-disease association. (HuGE Navigator)
17703100 There is a significant negative correlation between the intensity of skin test reaction and the ACP1 *B/*C genotype in allergic individuals.
17678914 Women homozygous for haptoglobin with low ACP1 activity are more likely to conceive in the first part of the year. Women heterozygous for haptoglobin with medium-high ACP1 activity are more likely to conceive in the last part of the year.
17565542 results suggest a cooperative effect of ADA and ACP1 genetic polymorphism on the susceptibility to repeated spontaneous abortion and to some of its clinical characteristics
17472574 Human recombinant LMWPTP-A displayed an RN5Pase activity that was higher than its tyrosine phosphatase activity, indicating that this phosphatase may participate in protein deglycation, a new form of protein repair.
17390764 Observational study of gene-disease association. (HuGE Navigator)
17171650 Observational study of gene-disease association. (HuGE Navigator)
16973312 Among newborns carrying the ACP1C allele there is an increase of Sex Ratio among the offspring of smoking mothers relative to non-smoking mothers.
16893901 GRX plays an important role in PDGF-BB-dependent cell proliferation by regulating the redox state of LMW-PTP
16762482 mother/newborn pairs: ACP1 (acid phosphatase 1)distribution has fewer pairs with maternal low ACP1 S isoform and infant high S isoform concentration;Recurrent spontaneous abortion couples show wife low S isoform and husband high S isoform concentration
16253994 Crystal structure of the second human low molecular weight PTPase isoenzyme provides the opportunity to examine the structural basis of different substrate and inhibitor/activator responses.
16224193 Observational study of gene-disease association. (HuGE Navigator)
16036221 Significant correlations between LMW-PTP overexpression and the most common clinical-pathological features of cancers exist. In colon cancer and neuroblastoma increased total LMW-PTP mRNA expression correlates with unfavourable outcome.
15988697 Observational study of gene-disease association. (HuGE Navigator)
15974295 Observational study of genotype prevalence. (HuGE Navigator)
15974295 Finds ACP1*C is a recessively deleterious allele that reduces viability during early life stages and is not maintained by overdominant selection in European populations.
15586390 Observational study of gene-disease association. (HuGE Navigator)
15586390 complex interaction among maternal age, sex of infant and ACP1 concerning age at diagnosis of diabetes
15359537 Observational study of gene-disease association. (HuGE Navigator)
15281007 Observational study of gene-disease association. (HuGE Navigator)
15281007 acid phosphatase 1 contributes to the clinical manifestations of type 2 diabetes and probably also have a marginal influence on susceptibility to the disease
15230135 Observational study of gene-disease association. (HuGE Navigator)
14637146 We show that the association of STAT5 and LMW-PTP does not exclusively involve the phosphatase active site and phosphotyrosine residue of STAT5.
12942785 The analysis involved the data on nine polymorphic codominant loci: HP, GC, TF, PI, PGM1, GLO1, C3, ACP1, and ESD. The loci were selected by significance of differences in genotype frequencies between tuberculosis patients and healthy controls
12815062 LMW-PTP has a role in immunological synapse establishment and stabilization through the negative control of FAK activity and of cell surface receptor redistribution
12640337 Observational study of gene-disease association. (HuGE Navigator)
12640337 Association of the ACP1 genotype with metabolic parameters upon initial diagnosis of type 1 diabetes.
12418966 Observational study of genotype prevalence. (HuGE Navigator)
12409270 Observational study of gene-disease association. (HuGE Navigator)
12231445 Observational study of gene-disease association. (HuGE Navigator)
12100313 ACP1 is associated with allergy
11963573 Observational study of genotype prevalence. (HuGE Navigator)
11912546 Observational study of gene-disease association. (HuGE Navigator)
11785295 Observational study of gene-disease association. (HuGE Navigator)
11534018 Observational study of gene-disease association. (HuGE Navigator)
11436564 Observational study of gene-disease association. (HuGE Navigator)
11369750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP      1 - 70
MSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE     71 - 140
TVYQQCVRCCRAFLEKAH                                                        141 - 158
//

Text Mined References (115)

PMID Year Title
26386860 2016 Hypermethylation of ACP1, BMP4, and TSPYL5 in Hepatocellular Carcinoma and Their Potential Clinical Significance.
26216523 2016 The effect of ACP1, ADA6 and PTPN22 genetic polymorphisms on the association between p53 codon 72 polymorphism and endometriosis.
26213100 2015 Deletion of low molecular weight protein tyrosine phosphatase (Acp1) protects against stress-induced cardiomyopathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25846885 2015 Association of ACP1 gene polymorphisms and coronary artery disease in northeast Chinese population.
25781955 2015 Activation of the low molecular weight protein tyrosine phosphatase in keratinocytes exposed to hyperosmotic stress.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25125338 2014 Type 1 diabetes mellitus. Comparison between the association with PTPN22 genotype and the association with ACP1-ADA1 joint genotype.
25123136 2014 Association between phosphatase related gene variants and coronary artery disease: case-control study and meta-analysis.
24933463 2014 Interaction between infectious diseases and personality traits: ACP1*C as a potential mediator.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23959645 2012 The Effect of ACP?-ADA? Genetic Interaction on Human Life Span.
23645747 2013 Characterization of low molecular weight protein tyrosine phosphatase isoforms in human breast cancer epithelial cell lines.
23621699 2013 Impact of polymorphisms affecting the ACP1 gene on levels of antibodies against platelet factor 4-heparin complexes.
23584899 2013 The role of low-molecular-weight protein tyrosine phosphatase (LMW-PTP ACP1) in oncogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23453606 2013 The association of PTPN22 polymorphism with endometriosis: effect of genetic and clinical factors.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23278455 2014 ACP1 genetic polymorphism and spermatic parameters in men with varicocele.
23197232 2012 p53 codon 72 polymorphism and coronary artery disease: evidence of interaction with ACP?.
22854047 2012 S-glutathionylation of LMW-PTP regulates VEGF-mediated FAK activation and endothelial cell migration.
22692348 2012 Acid phosphatase locus 1 genetic polymorphism and cancer grading.
22428720 2012 Lack of association of ACP1 gene with inflammatory bowel disease: a case-control study.
22064183 2012 Novel association of acid phosphatase locus 1*C allele with systemic lupus erythematosus.
22035742 2011 Array comparative genomic hybridization analysis identifies recurrent gain of chromosome 2p25.3 involving the ACP1 and MYCN genes in chronic lymphocytic leukemia.
21767392 2011 Association of acid phosphatase locus 1*C allele with the risk of cardiovascular events in rheumatoid arthritis patients.
21644204 2011 Association between ACP(1) genetic polymorphism and favism.
21538645 2011 Specificity of HCPTP variants toward EphA2 tyrosines by quantitative selected reaction monitoring.
21423239 2012 A genome-wide association study of attempted suicide.
21269460 2011 Initial characterization of the human central proteome.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20805743 2010 Is there a role of ACP1-ADA1 genetic complex in immune reaction? Association with T1D and with past malarial morbidity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20581655 2010 The interaction of ACP1, ADA1, diabetes and gender in coronary artery disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20152999 2011 The effect of genetic variability on the correlation between blood glucose and glycated hemoglobin levels.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19855922 2010 Body mass index and acid phosphatase locus 1 in diabetic disorders.
19789510 2009 Type 1 diabetes: evidence of interaction between ACP1 and ADA1 gene polymorphisms.
19622628 2009 Evidence for sex-specific associations between variation in acid phosphatase locus 1 (ACP1) and insulin sensitivity in Mexican-Americans.
19570551 2009 ACP1 genotype, glutathione reductase activity, and riboflavin uptake affect cardiovascular risk in the obese.
19569002 2008 The "Child in the Barrel syndrome"--severe pharyngeal-cervical-brachial variant of Guillain-Barre Syndrome in a toddler.
19246900 2009 ACP1 genetic polymorphism and coronary artery disease: an association study.
19217450 2009 A study of acid phosphatase locus 1 in women with high fat content and normal body mass index.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18992867 2009 Is there an association between uterine leiomyomas and acid phosphatase locus 1 polymorphism?
18786445 2008 ACP1 genetic polymorphism and colon cancer.
18768081 2008 The genetics of feto-placental development: a study of acid phosphatase locus 1 and adenosine deaminase polymorphisms in a consecutive series of newborn infants.
18604186 [Genetic polymorphisms of low molecular weight protein tyrosine phosphatase (LMW-PTP): relationship with erythrocyte enzymatic phenotype in patients with Systemic Lupus Erythematosus].
18490013 2008 Acid phosphatase locus 1 genetic polymorphism, endometriosis, and allergy.
18262048 2008 Low molecular weight protein tyrosine phosphatase genetic polymorphism and susceptibility to cancer development.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17703100 2008 Skin testing correlates negatively with high-activity ACP1 *B/*C genotype.
17678914 2008 The effects of genetic and seasonal factors on reproductive success.
17565542 2007 Repeated spontaneous abortion. Cooperative effects of ADA and ACP1 genetic polymorphisms.
17472574 2007 Identification of protein-ribulosamine-5-phosphatase as human low-molecular-mass protein tyrosine phosphatase-A.
17390764 Allergy and ACP1 genetic polymorphism.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17171650 2007 Dopaminergic polymorphisms in Tourette syndrome: association with the DAT gene (SLC6A3).
16973312 2007 ACP1 and offspring sex ratio in smoking puerperae: a study at population level.
16893901 2006 Glutaredoxin modulates platelet-derived growth factor-dependent cell signaling by regulating the redox status of low molecular weight protein-tyrosine phosphatase.
16762482 2008 Feto-maternal ACP1 activity ratio and intrauterine survival.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16253994 2006 Crystal structure of the human B-form low molecular weight phosphotyrosyl phosphatase at 1.6-A resolution.
16224193 2005 Genetic polymorphism and TH1/TH2 orientation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16036221 2005 Up-regulated expression of low molecular weight protein tyrosine phosphatases in different human cancers.
15988697 2005 Serum glucose concentration and ACP1 genotype in healthy adult subjects.
15974295 2004 European ACP1*C allele has recessive deleterious effects on early life viability.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15586390 Risk of type 1 diabetes in childhood and maternal age at delivery, interaction with ACP1 and sex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15359537 2004 Maternal cigarette smoking, metabolic enzyme polymorphism, and developmental events in the early stages of extrauterine life.
15281007 2004 Type 2 diabetes and the genetics of signal transduction: a study of interaction between adenosine deaminase and acid phosphatase locus 1 polymorphisms.
15230135 2004 [Allele polymorphism of alkaline phosphatase, acid soluble phosphatase, and vitamin D-binding protein genes in postmenopausal osteoporosis].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14637146 2003 LMW-PTP associates and dephosphorylates STAT5 interacting with its C-terminal domain.
12942785 2003 [The use of discrete characters in discriminant analysis for diagnosis of pulmonary tuberculosis and for classification of patients differing in treatment efficiency based on polymorphisms at nine codominant loci-HP, GC, TF, PI, PGM1, GLO1, C3, ACP1 and ESD].
12815062 2003 Lymphocyte function-associated antigen-1-mediated T cell adhesion is impaired by low molecular weight phosphotyrosine phosphatase-dependent inhibition of FAK activity.
12640337 2003 Association of the ACP1 genotype with metabolic parameters upon initial diagnosis of type 1 diabetes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438242 2002 Beta-catenin interacts with low-molecular-weight protein tyrosine phosphatase leading to cadherin-mediated cell-cell adhesion increase.
12418966 2002 Identification of two SNPs in the 5' flanking region of the ACP1 gene and evaluation of disequilibrium among polymorphic sites.
12409270 2002 Association of the acid phosphatase (ACP1) gene with triglyceride levels in obese women.
12231445 2002 Association between the low molecular weight cytosolic acid phosphatase gene ACP1*A and comorbid features of Tourette syndrome.
12167657 2002 Regulation of the EphA2 kinase by the low molecular weight tyrosine phosphatase induces transformation.
12100313 2002 ACP1 is associated with allergy.
11976341 2002 Activation of ZAP-70 through specific dephosphorylation at the inhibitory Tyr-292 by the low molecular weight phosphotyrosine phosphatase (LMPTP).
11971983 2002 Tyrosine phosphorylation regulates alpha II spectrin cleavage by calpain.
11963573 2002 [Genetic polymorphism of erythrocytic enzymes in Yakut populations].
11912546 2002 Genotypes of cytosolic low-molecular-weight protein-tyrosine-phosphatase correlate with age at onset of type 1 diabetes in a sex-specific manner.
11785295 2001 [Analysis of heterozygosity levels at P1,TF, PGM1, ACP1, HP, GC, GLO, C3, and ESD loci in pulmonary tuberculosis patients with different treatment outcomes].
11534018 2000 Adenosine deaminase-acid phosphatase association and the environment: A study in a continental Italian population.
11436564 2001 [Genetic predisposition to development of toxic liver cirrhosis caused by alcohol].
11369750 2001 The genetics of signal transduction and the effect of smoking on intrauterine growth.
10940933 2000 Subcellular localization of intracellular protein tyrosine phosphatases in T cells.
10608891 1999 HCPTPA, a protein tyrosine phosphatase that regulates vascular endothelial growth factor receptor-mediated signal transduction and biological activity.
10336608 1999 A novel isoform of the low molecular weight phosphotyrosine phosphatase, LMPTP-C, arising from alternative mRNA splicing.
9705307 1998 Crystal structure of a human low molecular weight phosphotyrosyl phosphatase. Implications for substrate specificity.
9684876 1998 Cloning, expression and characterisation of a new human low Mr phosphotyrosine protein phosphatase originating by alternative splicing.
9499402 1998 Eph receptors discriminate specific ligand oligomers to determine alternative signaling complexes, attachment, and assembly responses.
9038134 1997 Regulation of the low molecular weight phosphotyrosine phosphatase by phosphorylation at tyrosines 131 and 132.
8586411 1995 Gene structure, sequence, and chromosomal localization of the human red cell-type low-molecular-weight acid phosphotyrosyl phosphatase gene, ACP1.
8364553 1993 A TaqI site identifies the *A allele at the ACP1 locus.
4356849 1973 Expression of human red cell acid phosphatase activity in placenta and other tissues.
4065897 1985 Duplication of 2p25: confirmation of the assignment of soluble acid phosphatase (ACP1) locus to 2p25.
1939112 1991 Human red cell acid phosphatase (ACP1). The amino acid sequence of the two isozymes Bf and Bs encoded by the ACP1*B allele.
1627603 1992 Human red cell acid phosphatase (ACP1): the primary structure of the two pairs of isozymes encoded by the ACP1*A and ACP1*C alleles.
1587862 1992 Sequencing, cloning, and expression of human red cell-type acid phosphatase, a cytoplasmic phosphotyrosyl protein phosphatase.
1304913 1992 Identification of the adipocyte acid phosphatase as a PAO-sensitive tyrosyl phosphatase.
736044 1978 Phenotype dependence in the inhibition of red cell acid phosphatase (ACP) by folates.
457131 1979 Regional assignment of red cell acid phosphatase locus to band 2p25.