Property Summary

Ligand Count 5
NCBI Gene PubMed Count 115
PubMed Score 295.30
PubTator Score 247.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Alzheimer's disease -1.200 1.7e-02
Breast cancer 1.200 2.1e-09
group 3 medulloblastoma 1.600 6.7e-03
invasive ductal carcinoma 1.700 2.0e-04
lung cancer 2.200 1.1e-04
Multiple myeloma 1.528 5.3e-04
non primary Sjogren syndrome sicca 1.100 2.0e-02
non-small cell lung cancer 1.388 5.2e-18
osteosarcoma 1.372 1.5e-03
ovarian cancer -1.100 9.1e-03
Pick disease -1.100 4.8e-05

 GWAS Trait (1)

Protein-protein Interaction (3)

PDB (13)

Gene RIF (97)

AA Sequence

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP      1 - 70
MSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE     71 - 140
TVYQQCVRCCRAFLEKAH                                                        141 - 158
//

Text Mined References (120)

PMID Year Title