Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.46
PubTator Score 1.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -2.300 1.3e-03
lung adenocarcinoma -1.100 1.9e-04
lung cancer -3.500 5.0e-06
lung carcinoma -2.900 2.0e-25
non-small cell lung cancer -1.651 6.8e-28

Gene RIF (4)

AA Sequence

MRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGS      1 - 70
PEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMYIGNAMYGNYA     71 - 140
AVFAQLIIDGRSQGPHCFIVPVRDENGSLYPGVTAIDMMYKEGLHGVDNGILIFDKVRIPRENLLDKFGS    141 - 210
VAPDGQYHSPIRNKSARFNAMLAALTPSRLAVAFQAMGAMKLGLTIAIRYSHSRRQFGPKTKEEVKIIEH    211 - 280
QTQTLRLMPHLATALALTFVSRYAGALLDEDVFQGKELVNSRSLQALVAGLKAYSTWENIRCLQDCRECT    281 - 350
GGMGYMMENRISGLKCDTDVFATFEGDDVVMLQVVGRELLAQYTKQYEEKPLFGLLQNWAESVGDKLRTS    351 - 420
FLAFNMDTVDDLAFLLKAVKFRERVLQRGLVARIYYKVKTKKEDFFHAWNSCLHHVASLSLAHTHRVTLE    421 - 490
QFSLAVKSCPDQEDQTLLMKFCLLYGTKLVFQERAWYLEHKYLTPMASTRIRNQERC                 491 - 547
//

Text Mined References (20)

PMID Year Title