Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -2.053 3.2e-05
glioblastoma 1.300 3.1e-03
group 4 medulloblastoma -1.400 1.8e-04
medulloblastoma, large-cell -1.500 3.1e-03
primitive neuroectodermal tumor -1.600 2.1e-02
non-small cell lung cancer -1.142 2.3e-16
lung cancer 1.300 3.7e-02
subependymal giant cell astrocytoma 1.013 2.0e-02
lung carcinoma -1.600 2.0e-30
ovarian cancer -2.100 3.3e-08

AA Sequence

MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSF      1 - 70
LAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMS     71 - 140
PLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSEN    141 - 210
KGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRV    211 - 280
LPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVE    281 - 350
VGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQR    351 - 420
HFNSMSGPATLRKDYLVEP                                                       421 - 439
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10383425 1999 Molecular cloning and characterization of MT-ACT48, a novel mitochondrial acyl-CoA thioesterase.