Property Summary

NCBI Gene PubMed Count 24
PubMed Score 254.59
PubTator Score 25.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.400 1.5e-04
Atopic dermatitis -1.100 5.5e-05
atypical teratoid / rhabdoid tumor -1.400 4.8e-08
intraductal papillary-mucinous neoplasm ... 2.200 8.9e-05
medulloblastoma, large-cell -1.400 2.2e-05
osteosarcoma 1.266 5.2e-04
ovarian cancer 1.600 1.3e-05
psoriasis 1.500 6.9e-04
spina bifida -1.094 4.1e-02
ulcerative colitis -1.100 1.2e-05

Protein-protein Interaction (3)

Gene RIF (12)

AA Sequence

MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKS      1 - 70
VSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQF     71 - 140
SMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVR    141 - 210
ARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWA    211 - 280
GGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL                                   281 - 319
//

Text Mined References (26)

PMID Year Title