Property Summary

NCBI Gene PubMed Count 17
PubMed Score 106.76
PubTator Score 295.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -2.400 3.8e-03
ependymoma -2.500 7.5e-03
oligodendroglioma -1.800 3.1e-02
psoriasis 1.400 2.1e-04
glioblastoma -1.600 1.3e-04
group 4 medulloblastoma -1.900 4.0e-05
atypical teratoid / rhabdoid tumor -1.700 3.8e-08
medulloblastoma, large-cell -1.100 3.7e-03
pancreatic ductal adenocarcinoma liver m... 1.291 4.0e-02
intraductal papillary-mucinous carcinoma... 2.100 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.900 2.1e-03
interstitial cystitis 1.100 1.3e-03
adult high grade glioma -2.200 1.4e-05
pilocytic astrocytoma -1.900 7.2e-08
subependymal giant cell astrocytoma -1.709 4.4e-02
Pick disease -1.400 9.1e-03
Breast cancer 1.200 1.0e-07
gastric carcinoma 1.300 4.9e-02
invasive ductal carcinoma 1.600 2.0e-04

Gene RIF (5)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
15592755 BACH was deranged in hippocampus of mesial temporal lobe epilepsy patients.
12435388 the human BACH gene can express long-chain acyl-CoA hydrolase activity in multiple intracellular compartments by generating BACH isoforms with differential localization signals to affect various cellular functions that involve acyl-CoAs

AA Sequence

MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGN      1 - 70
VHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQV     71 - 140
NVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGD    141 - 210
IVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINF    211 - 280
HDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPE    281 - 350
TEDEKKRFEEGKGRYLQMKAKRQGHAEPQP                                            351 - 380
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15731883 2005 Long-chain acyl-CoA hydrolase in the brain.
15592755 2004 Aberrant cytosolic acyl-CoA thioester hydrolase in hippocampus of patients with mesial temporal lobe epilepsy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435388 2002 Human brain acyl-CoA hydrolase isoforms encoded by a single gene.
10578051 1999 Purification, molecular cloning, and genomic organization of human brain long-chain acyl-CoA hydrolase.