Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.1e-06

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 2.1e-06

Synonym

Accession Q3I5F7 Putative acyl-CoA thioesterase 6
Symbols C14orf42
c14_5530

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKI      1 - 70
TKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASERLQAHGKERPQIIC     71 - 140
YPETGHCIDPPYFPPSRASVHAVLGEAIFYGGEPKAHSKAQVDAWQQIQTFFHKHLNGKKSVKHSKI       141 - 207
//

Text Mined References (5)

PMID Year Title