Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.83
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 3.3e-03
ependymoma -1.500 2.1e-03
oligodendroglioma -1.300 1.0e-03
atypical teratoid / rhabdoid tumor -1.100 8.1e-04
medulloblastoma -1.300 1.1e-03
medulloblastoma, large-cell -1.100 2.9e-02
primitive neuroectodermal tumor -1.100 8.7e-03
pancreatic ductal adenocarcinoma liver m... -2.035 3.0e-04
ulcerative colitis -1.100 2.2e-05

Gene RIF (2)

PMID Text
25961151 Exome sequencing revealed an association with ACOT4 and increased risk of ischemic stroke.
16141203 ACOT4 and ACOT8 are responsible for the termination of beta-oxidation of dicarboxylic acids of medium-chain length with the concomitant release of the corresponding free acids

AA Sequence

MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGELDLERAPALGG      1 - 70
SFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLLCQAQHERHFLPPGVRRQSVR     71 - 140
AGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEE    141 - 210
AVCYMLQHPQVKGPGIGLLGISLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLR    211 - 280
RIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKP    281 - 350
QIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK    351 - 420
L//

Text Mined References (13)

PMID Year Title
25961151 2015 Rare and Coding Region Genetic Variants Associated With Risk of Ischemic Stroke: The NHLBI Exome Sequence Project.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16940157 2006 Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.
16141203 2005 The identification of a succinyl-CoA thioesterase suggests a novel pathway for succinate production in peroxisomes.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10944470 2000 Identification of PTE2, a human peroxisomal long-chain acyl-CoA thioesterase.
10567408 1999 Peroxisome proliferator-induced long chain acyl-CoA thioesterases comprise a highly conserved novel multi-gene family involved in lipid metabolism.
7596406 1995 Cloning of a gene bearing missense mutations in early-onset familial Alzheimer's disease.