Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.43
PubTator Score 9.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.9e-49

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.9e-49

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPARMAATLILE      1 - 70
PAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGGSFAGLEPM     71 - 140
GLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLLCQTRHERYFLPPGVRREPVRVGRVRGTL    141 - 210
FLPPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHLEYFEEAMNYLLSH    211 - 280
PEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLHYKGETLPPVGVNRNRIKVTKDG    281 - 350
YADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPET    351 - 420
GHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSKV           421 - 483
//

Text Mined References (16)

PMID Year Title