Property Summary

NCBI Gene PubMed Count 38
PubMed Score 157.19
PubTator Score 126.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Kidney cancer 2548 0.0 0.5
Disease Target Count Z-score Confidence
Neurodegenerative disease 402 0.0 4.0

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 3.8e-03
glioblastoma -1.300 6.9e-05
Multiple myeloma 1.074 2.5e-03
non primary Sjogren syndrome sicca 1.200 3.0e-02
ovarian cancer 2.000 6.9e-06
pediatric high grade glioma -1.200 5.5e-06
psoriasis 2.200 1.7e-05

Gene RIF (16)

AA Sequence

MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIV      1 - 70
YGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDL     71 - 140
RRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGG    141 - 210
ADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGM    211 - 280
ATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHIN    281 - 350
GPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS    351 - 420
EQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFV    421 - 490
TSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSP    491 - 560
TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKAN    561 - 630
SVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLK    631 - 700
KQGLLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGS    701 - 770
ALNRMKELQQ                                                                771 - 780
//

Text Mined References (44)

PMID Year Title