Property Summary

NCBI Gene PubMed Count 70
PubMed Score 391.34
PubTator Score 213.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.700 6.2e-07
osteosarcoma 1.372 8.3e-03
adrenocortical carcinoma -1.079 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.916 3.9e-03
lung cancer -1.400 7.0e-03
breast carcinoma -1.600 3.0e-03
fibroadenoma -2.000 4.2e-02
Breast cancer 2.300 2.8e-02
aldosterone-producing adenoma -1.027 1.8e-02
ductal carcinoma in situ -2.200 6.7e-04
invasive ductal carcinoma -2.800 2.9e-03
ovarian cancer 1.100 6.4e-04

Gene RIF (45)

PMID Text
26778000 Our results confirm the observation that mitoNEET is important in transferring the iron sulfur clusters to the cytosolic aconitase in living cells and the His-87 ligand in mitoNEET plays important role in this process.
26755275 The SNP rs7874815 in the ACO1 gene was strongly associated with survival in pancreatic cancer.
26296460 These in vitro studies suggest that human GLRX3 is important for cytosolic Fe-S protein maturation.
25727755 Data show that IRP1 suppressed TfR1/DMT1 (+IRE) expression, limited the cellular iron content and decreased lactate dehydrogenase (LDH) release induced by hypoxia.
25550467 ACO1 gene expression was positively associated with adipogenic markers in subcutaneous and visceral adipose tissue.
25144566 ACO1 genetic variation is associated with neuropathic pain and pain severity in HIV-infected patients on antiretroviral therapy
25106854 Polymer-dependent translocation of IRP-1 in Cd(2+)-exposed cells may underlie effects of Cd(2+) on iron homeostasis.
25012650 MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/IRP1.
24909164 SIRT3 overexpression decreases TfR1 expression by inhibiting IRP1 and represses proliferation in pancreatic cancer cells.
23935819 Data indicate that JTR-009, a benzimidazole, operated by preventing iron-regulatory protein-1 (IRP1) from binding to the iron-responsive element (IRE) in APP mRNA.
23817740 Studies indicate that several genes have been linked to iron homeostasis, including transferrin (TF), iron regulatory protein 1 (ACO1) and transferrin receptor 2 (TFR2).
23615448 Data indicate that silencing of Grx3 in HeLa cells decreases the activities of several cytosolic Fe/S proteins, including iron-regulatory protein 1, a major component of posttranscriptional iron regulation.
22544036 The RNA-binding and aconitase forms of IRP-1 can undergo interconversion dependent on the density of cells growing in culture.
22502979 Lead specifically induces dysregulation of IRP1 protein by activating the ERK1/2 signaling pathway indicating a novel role for IRP1 and the ERK/MAPK pathway in vascular endothelial functions.
22331484 Ggenetic polymorphisms of the iron regulatory protein 1 and 2 genes may be associated with development of age-related macular degeneration.
22020773 Molecular genetic analysis revealed point mutations within the FTL IRE.
21360641 Dual-luciferase reporter assay showed that iron regulatory protein 1 (IRP)1 was directly downregulated by hypoxia-inducible factor 1/hypoxia response element system.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20574843 Single nucleotide polymorphism in ACO1 gene is associated with cutaneous malignant melanoma.
20574843 Observational study of gene-disease association. (HuGE Navigator)
20569198 ATP/ADP binding maintains IRP-1 in a non-IRE-binding state.
20558735 Selective translational control of the Alzheimer amyloid precursor protein transcript by iron regulatory protein-1.
20354189 iron regulatory protein-1-mediated inhibition of hypoxia-inducible factor-2a translation is linked to the anti-inflammatory 15-deoxy-delta12,14-prostaglandin J2
19688112 This study shows that expression of the transferrin receptor (TfR) is downregulated, whereas expression of the ferritin heavy chain is upregulated in Chlamydia trachomatis infected HeLa-229 cells.
18262302 Downregulated by HBX in human hepatoma cell lines.
17877204 Expression of TfR1 mRNA is increased when maternal iron deficiency progressed while there is no change in the expression of IRP1 mRNA in the placenta.
17613866 Hypertransfusional (>8 transfusions/year) iron in liver biopsies correlated with increased expression (RNA) for iron regulatory proteins 1 and 2 (3-, 9- to 11-fold) and hepcidin RNA: (5- to 8-fold), while ferritin H and L RNA remained constant.
17604281 analysis of the iron regulatory protein system
17521334 Although the iron-responsive element does not itself hydrolyze ATP, its presence enhances iron regulatory protein-1's ATPase activity, and ATP hydrolysis results in loss of the complex in gel shift assays.
17244191 Thus, proper folding of human iron regulatory protein 1 strongly depends on its cellular environment, in contrast to other members of the aconitase family.
17200797 Results describe thet effect of hypoxia on the binding and subcellular distribution of iron regulatory proteins 1 and 2.
17127713 Overexpression of iron regulatory protein 1 suppresses growth of tumor xenografts
16503547 IRP1 activity level is higher in monocytes and macrophages of hereditary hemochrosis (HH) patients than in those of control subjects, and is increased in the duodenal samples of the patients with HH and iron-deficiency anemia.
16424901 IRP1 controls iron homeostasis during cell proliferation, inflammation, and in response to diseases altering cytosolic Fe-S cluster assembly or disassembly.
16407072 Comparison of IRP1 in its aconitase form with known structures of homologous enzymes reveals well-conserved folds and active site environments with significantly different surface shapes and charge distributions.
15938636 Apo-IRP1 exists as an equilibrium mixture of monomers and dimers in solution; however, only monomeric IRP1 is observed in complex with the iron regulatory element (IRE).
15543932 iron-replete HepG2 cells exhibit a narrow range of maximal responsiveness of the IRP-regulatory mechanism
15349772 Toxoplasma gondii infection resulted in increased activity in the iron response protein IRP1, which, in this state, stabilizes transferrin receptor mRNA from degradation.
12972614 A phosphomimetic mutation at Ser-138 renders IRP1 sensitive to iron-dependent degradation.
12855587 data suggest that the differential regulation of IRP1 and IRP2 during hypoxia may be important for cellular adaptation to low oxygen tension.
12572667 functional in the activation of iron uptake
12196178 liver levels or this protein are down-regulated in hemochromatosis
11812787 Structural changes associated with switching activities of human iron regulatory protein 1
11783942 gene coding and flanking regions were sequenced and examined for mutations that might modulate the iron burden of individuals harboring the common mutant hemochromatosis HFE genotype or cause hemochromatosis independent of mutations in the HFE gene
8041788 Aco1 encodes a moonlighting protein that has aconitase activity as well as mRNA binding ability.

AA Sequence

MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQ      1 - 70
HKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQ     71 - 140
KNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTM    141 - 210
IDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEF    211 - 280
FGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPS    281 - 350
QDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNT    351 - 420
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPY    421 - 490
LSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAY    491 - 560
AIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS    561 - 630
DKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRG    631 - 700
LTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLA    701 - 770
GKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIP    771 - 840
ENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK                         841 - 889
//

Text Mined References (75)

PMID Year Title
26778000 2016 His-87 ligand in mitoNEET is crucial for the transfer of iron sulfur clusters from mitochondria to cytosolic aconitase.
26755275 2016 Circulating Metabolites and Survival Among Patients With Pancreatic Cancer.
26296460 2015 Human glutaredoxin 3 can bind and effectively transfer [4Fe-4S] cluster to apo-iron regulatory protein 1.
25727755 2015 Iron Regulatory Protein 1 Suppresses Hypoxia-Induced Iron Uptake Proteins Expression and Decreases Iron Levels in HepG2 Cells.
25550467 2015 Cytosolic aconitase activity sustains adipogenic capacity of adipose tissue connecting iron metabolism and adipogenesis.
25144566 2014 Genetic variation in iron metabolism is associated with neuropathic pain and pain severity in HIV-infected patients on antiretroviral therapy.
25106854 2014 Cadmium-induced aggregation of iron regulatory protein-1.
25012650 2014 The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1.
24909164 2015 SIRT3 regulates cellular iron metabolism and cancer growth by repressing iron regulatory protein 1.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23935819 2013 Novel 5' untranslated region directed blockers of iron-regulatory protein-1 dependent amyloid precursor protein translation: implications for down syndrome and Alzheimer's disease.
23817740 2013 Neuroimaging, nutrition, and iron-related genes.
23615448 2013 Crucial function of vertebrate glutaredoxin 3 (PICOT) in iron homeostasis and hemoglobin maturation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22561531 2012 Genome-wide association study to identify genetic determinants of severe asthma.
22544036 2012 Cell density-dependent shift in activity of iron regulatory protein 1 (IRP-1)/cytosolic (c-)aconitase.
22502979 2012 Lead induces dysregulation of iron regulatory protein 1 via the extracellular signal-regulated kinase pathway in human vascular endothelial cells.
22331484 2012 Genetic polymorphism of the iron-regulatory protein-1 and -2 genes in age-related macular degeneration.
22020773 2011 Hereditary hyperferritinemia cataract syndrome: clinical, genetic, and laboratory findings in 5 families.
21360641 2011 Effect of hypoxia on the expression of iron regulatory proteins 1 and the mechanisms involved.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
20569198 2010 Interaction of iron regulatory protein-1 (IRP-1) with ATP/ADP maintains a non-IRE-binding state.
20558735 2010 Selective translational control of the Alzheimer amyloid precursor protein transcript by iron regulatory protein-1.
20354189 2010 The connectivity map links iron regulatory protein-1-mediated inhibition of hypoxia-inducible factor-2a translation to the anti-inflammatory 15-deoxy-delta12,14-prostaglandin J2.
20053667 2010 Molecular control of the cytosolic aconitase/IRP1 switch by extramitochondrial frataxin.
19762597 2009 An E3 ligase possessing an iron-responsive hemerythrin domain is a regulator of iron homeostasis.
19762596 2009 Control of iron homeostasis by an iron-regulated ubiquitin ligase.
19688112 2009 Chlamydia trachomatis alters iron-regulatory protein-1 binding capacity and modulates cellular iron homeostasis in HeLa-229 cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18262302 2008 HBx modulates iron regulatory protein 1-mediated iron metabolism via reactive oxygen species.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17877204 2007 [The expression of TfR1 mRNA and IRP1 mRNA in the placenta from different maternal iron status].
17613866 2007 Iron homeostasis during transfusional iron overload in beta-thalassemia and sickle cell disease: changes in iron regulatory protein, hepcidin, and ferritin expression.
17604281 2007 Excess capacity of the iron regulatory protein system.
17521334 2007 Inhibition of an iron-responsive element/iron regulatory protein-1 complex by ATP binding and hydrolysis.
17244191 2007 Folding and turnover of human iron regulatory protein 1 depend on its subcellular localization.
17200797 2007 Effect of hypoxia on the binding and subcellular distribution of iron regulatory proteins.
17127713 2007 Overexpression of iron regulatory protein 1 suppresses growth of tumor xenografts.
16527810 2006 Roles of the mammalian cytosolic cysteine desulfurase, ISCS, and scaffold protein, ISCU, in iron-sulfur cluster assembly.
16503547 2006 Iron regulatory proteins 1 and 2 in human monocytes, macrophages and duodenum: expression and regulation in hereditary hemochromatosis and iron deficiency.
16424901 2006 Iron-responsive degradation of iron-regulatory protein 1 does not require the Fe-S cluster.
16407072 2006 Crystal structure of human iron regulatory protein 1 as cytosolic aconitase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16144863 2005 Subcellular localization of iron regulatory proteins to Golgi and ER membranes.
15938636 2005 Self-association and ligand-induced conformational changes of iron regulatory proteins 1 and 2.
15543932 2004 Iron accumulation and iron-regulatory protein activity in human hepatoma (HepG2) cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15349772 2004 Transferrin receptor induction in Toxoplasma gondii-infected HFF is associated with increased iron-responsive protein 1 activity and is mediated by secreted factors.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15099026 2004 Intracellular ferritin accumulation in neural and extraneural tissue characterizes a neurodegenerative disease associated with a mutation in the ferritin light polypeptide gene.
12972614 2003 A phosphomimetic mutation at Ser-138 renders iron regulatory protein 1 sensitive to iron-dependent degradation.
12855587 2003 Effects of iron regulatory protein regulation on iron homeostasis during hypoxia.
12572667 2003 Iron-activated iron uptake: a positive feedback loop mediated by iron regulatory protein 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12196178 2002 Down-regulation of liver iron-regulatory protein 1 in haemochromatosis.
11783942 A study of genes that may modulate the expression of hereditary hemochromatosis: transferrin receptor-1, ferroportin, ceruloplasmin, ferritin light and heavy chains, iron regulatory proteins (IRP)-1 and -2, and hepcidin.
10944468 2000 cDNA cloning by amplification of circularized first strand cDNAs reveals non-IRE-regulated iron-responsive mRNAs.
10419470 1999 Human cytoplasmic aconitase (Iron regulatory protein 1) is converted into its [3Fe-4S] form by hydrogen peroxide in vitro but is not activated for iron-responsive element binding.
9020582 1997 The aconitase family: three structural variations on a common theme.
8764614 1996 Demonstration and characterization of the iron regulatory protein in human brain.
8262977 1993 Iron-responsive element-binding protein. Phosphorylation by protein kinase C.
8041788 1994 The bifunctional iron-responsive element binding protein/cytosolic aconitase: the role of active-site residues in ligand binding and regulation.
2771641 1989 Chromosomal localization of nucleic acid-binding proteins by affinity mapping: assignment of the IRE-binding protein gene to human chromosome 9.
2172968 1990 Cloning of the cDNA encoding an RNA regulatory protein--the human iron-responsive element-binding protein.
1946430 1991 A regulated RNA binding protein also possesses aconitase activity.
1903202 1991 Homology between IRE-BP, a regulatory RNA-binding protein, aconitase, and isopropylmalate isomerase.
1738601 1992 Expression of active iron regulatory factor from a full-length human cDNA by in vitro transcription/translation.