Property Summary

NCBI Gene PubMed Count 73
PubMed Score 396.48
PubTator Score 213.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.079 1.1e-05
aldosterone-producing adenoma -1.027 1.8e-02
Breast cancer 2.300 2.8e-02
breast carcinoma -1.600 3.0e-03
ductal carcinoma in situ -2.200 6.7e-04
fibroadenoma -2.000 4.2e-02
invasive ductal carcinoma -2.800 2.9e-03
lung cancer -1.400 7.0e-03
malignant mesothelioma -1.700 6.2e-07
osteosarcoma 1.305 9.6e-04
ovarian cancer 1.100 6.4e-04
pancreatic ductal adenocarcinoma liver m... -1.916 3.9e-03

Gene RIF (47)

AA Sequence

MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQ      1 - 70
HKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQ     71 - 140
KNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTM    141 - 210
IDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEF    211 - 280
FGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPS    281 - 350
QDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNT    351 - 420
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPY    421 - 490
LSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAY    491 - 560
AIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS    561 - 630
DKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRG    631 - 700
LTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLA    701 - 770
GKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIP    771 - 840
ENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK                         841 - 889
//

Text Mined References (78)

PMID Year Title