Property Summary

NCBI Gene PubMed Count 22
PubMed Score 45.96
PubTator Score 20.94

Knowledge Summary

Patent (27,471)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 93 0.0 0.0
Disease Target Count
Spontaneous abortion 97
Disease Target Count P-value
lung adenocarcinoma 2627 5.4e-18
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Photosensitive epilepsy 10 3.888 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 5.4e-18

Gene RIF (9)

AA Sequence

MALEQNQSTDYYYEENEMNGTYDYSQYELICIKEDVREFAKVFLPVFLTIVFVIGLAGNSMVVAIYAYYK      1 - 70
KQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISIDRYVA     71 - 140
VTKVPSQSGVGKPCWIICFCVWMAAILLSIPQLVFYTVNDNARCIPIFPRYLGTSMKALIQMLEICIGFV    141 - 210
VPFLIMGVCYFITARTLMKMPNIKISRPLKVLLTVVIVFIVTQLPYNIVKFCRAIDIIYSLITSCNMSKR    211 - 280
MDIAIQVTESIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFSI    281 - 350
//

Text Mined References (26)

PMID Year Title