Property Summary

Ligand Count 12
NCBI Gene PubMed Count 176
PubMed Score 99.03
PubTator Score 166.49

Knowledge Summary

Patent (16,864)

TINX Plot

  Disease (6)

Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.2
Disease Target Count Z-score Confidence
Cancer 2499 3.768 1.9
WHIM syndrome 7 3.042 1.5

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 2.597 1.4e-03
aldosterone-producing adenoma -1.305 4.9e-02
astrocytoma 1.900 5.2e-17
Atopic dermatitis -1.800 8.9e-04
atypical teratoid / rhabdoid tumor -1.300 2.3e-02
Breast cancer 3.000 4.8e-02
breast carcinoma -1.400 2.2e-03
chronic rhinosinusitis -1.336 3.4e-02
dermatomyositis 1.600 1.3e-02
ductal carcinoma in situ -2.200 2.4e-03
ependymoma 1.400 6.9e-04
fascioscapulohumeral muscular dystrophy 1.298 1.9e-03
fibroadenoma -2.000 1.1e-02
gastric cancer 1.100 2.9e-02
glioblastoma 1.400 1.3e-03
group 4 medulloblastoma -2.200 1.3e-04
hepatocellular carcinoma 1.100 3.2e-03
intraductal papillary-mucinous adenoma (... -2.900 3.0e-03
intraductal papillary-mucinous carcinoma... -3.600 2.5e-03
intraductal papillary-mucinous neoplasm ... -2.500 2.1e-02
invasive ductal carcinoma -1.900 3.6e-02
lung adenocarcinoma -1.311 5.0e-04
lung cancer -1.500 1.4e-04
malignant mesothelioma 4.400 2.5e-08
oligodendroglioma 1.500 2.5e-10
ovarian cancer -1.900 1.0e-02
pituitary cancer -2.700 4.1e-06
psoriasis -1.100 3.1e-04
tuberculosis -3.200 8.1e-06
ulcerative colitis 2.500 1.6e-05

Protein-protein Interaction (4)

Gene RIF (160)

AA Sequence

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNI      1 - 70
QAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSV     71 - 140
DRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLI    141 - 210
GMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSIL    211 - 280
HYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVS    281 - 350
ETEYSALEQSTK                                                              351 - 362
//

Text Mined References (184)

PMID Year Title