Property Summary

NCBI Gene PubMed Count 53
PubMed Score 162.83
PubTator Score 51.39

Knowledge Summary

Patent (47,111)

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.139 4.1e-05
ovarian cancer 1.200 8.1e-07
psoriasis 1.800 6.7e-04

Protein-protein Interaction (1)

Gene RIF (34)

AA Sequence

MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMV      1 - 70
LLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSL     71 - 140
DKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFGGHGTIWKLFL    141 - 210
RFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQV    211 - 280
FGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES    281 - 350
SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA                                        351 - 384
//

Text Mined References (59)

PMID Year Title