Property Summary

NCBI Gene PubMed Count 122
PubMed Score 621.64
PubTator Score 409.05

Knowledge Summary

Patent (43,303)

Expression

  Differential Expression (24)

Disease log2 FC p
psoriasis -1.200 9.3e-06
osteosarcoma -2.455 2.7e-02
glioblastoma -1.200 1.2e-03
atypical teratoid/rhabdoid tumor -2.300 2.5e-08
Duchenne muscular dystrophy 1.143 4.8e-07
autosomal dominant Emery-Dreifuss muscul... 1.006 3.2e-03
acute quadriplegic myopathy 1.393 7.2e-08
non-small cell lung cancer -3.391 4.0e-20
intraductal papillary-mucinous adenoma (... -3.500 8.7e-06
intraductal papillary-mucinous carcinoma... -3.600 1.0e-05
intraductal papillary-mucinous neoplasm ... -3.500 4.7e-04
Breast cancer -2.800 4.5e-02
interstitial cystitis 2.300 6.5e-05
cystic fibrosis 1.100 5.3e-03
pilocytic astrocytoma -1.100 1.0e-02
primary Sjogren syndrome 1.500 4.6e-04
subependymal giant cell astrocytoma -1.810 4.4e-02
lung adenocarcinoma -1.683 7.2e-11
breast carcinoma -1.500 1.7e-12
pterygium 1.400 1.3e-02
ductal carcinoma in situ -1.300 6.0e-03
invasive ductal carcinoma -3.300 3.3e-04
ulcerative colitis 1.800 8.5e-05
pituitary cancer 1.200 1.1e-02

Protein-protein Interaction (1)

Gene RIF (103)

PMID Text
26320997 DARC is required for Staphylococcus aureus-mediated lysis of human erythrocytes, and DARC overexpression is sufficient to render cells susceptible to toxin-mediated lysis.
26096170 We showed that DARC expression is down-regulated in CRC and associated with clinical pathological features and MVD of CRC. DARC might be involved in tumorigenesis, progression, angiogenesis, and metastasis of CRC.
26045366 DARC levels are elevated in human keloid fibroblasts and might inhibit the secretion of CCL2.
25817587 the odds for neutropenia in the ACKR1-null (FY-) individuals were 46-fold higher than for FY+ individuals (Crude odds ratio = 46, 95% confidence interval = 8.03-263, P < 0.001)
25647274 study demonstrates the association of SNP rs12075 from DARC gene with the levels of serum IL8
25582271 Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients.
24981451 DARC facilitates CXCL1 inhibition of airway smooth muscle cell migration via modulation of the ERK-1/2 MAP kinase signaling pathway.
24929836 The majority of our population is heterozygous for Duffy antigens a and b.
24845979 Duffy blood group
24710306 DARC polymorphisms may influence the naturally acquired inhibitory anti-Duffy binding protein II immunity
24415938 Isothermal titration calorimetry studies show these structures are part of a multi-step binding pathway, and individual point mutations of residues contacting DARC result in a complete loss of RBC binding by DBP-RII.
24260134 Effect of genetic variants in two chemokine decoy receptor genes, DARC and CCBP2, on metastatic potential of breast cancer.
23820435 The Fy(a-b-) phenotype in three siblings of the Polish family was caused by the FY(*)X/FY(*)B-33 genotype.
23753024 DARC antigen is associated with a likelihood for patients to develop leg ulcers in sickle cell disease.
23462454 co-expression of DARC, D6, and CCX-CKR significantly associated with higher survival in gastric cancer
23347639 The high frequency of the FYES allele that silences erythroid expression of the Duffy antigen offers a biologically plausible explanation for the lack of Plasmodium vivax infections observed.
23259672 Although lower, the risk of Duffy-negatives to experience a P. vivax blood stage infection was not significantly different to that of Duffy-positives.
23224555 platelet molecule platelet factor 4 (PF4 or CXCL4) and the erythrocyte Duffy-antigen receptor (Fy) are necessary for platelet-mediated killing of Plasmodium falciparum parasites.
23168236 DARC and BCAM expression was associated with pathogenesis of thyroid carcinoma and correlated with clinical-pathological features.
23028857 vivax malaria incidences over the past five years in an Indian population were significantly negatively and positively associated with the frequencies of the FY*A and FY*B alleles of the Duffy gene, respectively.
23017229 strong associations between SNPs in DARC gene, particularly rs12075, and serum MCP-1 levels identify a potential candidate gene that can be explored for its role in inflammatory pathways; replication of European GWAS of MCP-1 in study of Hispanic children confirms importance of DARC in regulation of MCP-1
22910367 The in fl uence of DARC gene expression on bone mineral density of the mandible was not con fi rmed.
22744181 Data suggest that DARC (Duffy antigen receptor for chemokines) gene may play an important role in regulating the metabolisms of both lean body mass (LBM) and age at menarche (AAM).
22207676 Our results provide evidence that the functional rs2814778 polymorphism in the gene encoding DARC is associated with worse clinical outcomes among African Americans with ALI, possibly via an increase in circulating IL-8.
22123959 findings show that Fy(a), compared with Fy(b), significantly diminishes binding of Pv Duffy binding protein (PvDBP) at the erythrocyte surface, and is associated with a reduced risk of clinical Plasmodium vivax in humans
22097233 Here we describe the recent success in mapping the gene that underlies benign neutropenia in African American populations. We discuss the known function of the gene and consider potential mechanisms for the effect on neutropenia.[review]
22082243 We developed a phylogenetic tree for DARC alleles and postulated a distinct FY*B allele as ancestral for the extant DARC alleles in humans.
22037903 Data show that in ancestry to the African continent (AA) subjects, the region surrounding the Duffy antigen/chemokine receptor gene (DARC) on 1q21 exhibited significant association with white blood cell count (WBC) levels.
21784153 It seems that this version of DARC receptor is a powerful facilitator of chemokine transcytosis and subsequently leukocyte migration into GVHD target organs.
21507922 DARC -46C/C results in loss of DARC expression on erthyrocytes (Duffy-null) and resistance to Plasmodium vivax malaria, and subjects with this genotype had pre-HIV seroconversion neutrophil counts of <2500 cells/mm(3).
21156192 despite an association of CCL2 serum levels with the severity of liver fi brosis, a functional SNP in the CCL2 scavenger receptor DARC is not directly associated with the occurrence or the severity of liver disease in hepatitis C infection infection
21151196 DARC and D6, the most studied members of this group of molecules, are reviewed.
21088296 This activation state associated with DARC RBC expression may influence the intensity of the inflammatory responses encountered in sickle cell anemia and participate in its interindividual clinical expression variability.
20664684 Results indicate that one of the primary mechanisms by which P. vivax evades host immunity is through DARC indirectly down-regulating humoral responses against erythrocytic invasion and development.
20664684 Observational study of gene-disease association. (HuGE Navigator)
20655790 Plasmodium vivax is able to infect and cause Malaria vivax in Duffy-negative people.
20655787 Duffy Antigen Receptor for Chemokines (DARC) is an unusual transmembrane chemokine receptor which binds the two main chemokine families.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20596779 results do not support an effect of erythrocyte DARC expression on the risk or progression of prostate cancer in men of African descent.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20560530 Observational study of genetic testing. (HuGE Navigator)
20431033 Observational study of genetic testing. (HuGE Navigator)
20347396 Duffy-positive sickle cell anemia patients exhibited higher counts of white blood cells, polynuclear neutrophils, higher plasma levels of IL-8 and RANTES than Duffy-negative patients.
20231434 Observational study of gene-disease association. (HuGE Navigator)
20199879 DARC-positive sickle-cell RBCs are more susceptible to inflammatory chemokines leading to Gardos channel activation & cellular dehydration, suggesting a coupling, promoted by the sickling process, between DARC and the GC.
20162434 Observational study of gene-disease association. (HuGE Navigator)
20040767 Genome-wide association analysis finds strong association for serum MCP-1 with a nonsynonymous polymorphism, rs12075 (Asp42Gly) in DARC.
19927622 increased expression is associated with ovalocytosis in Southeast Asia
19927622 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19822078 The Duffy antigen only minimally alters the pharmacokinetics of rhMCP-1 for doses up to 2 microg/kg.
19620399 The interaction between DARC genotype and the cellular milieu defined by WBC counts may influence HIV disease course.
19620399 Observational study of gene-disease association. (HuGE Navigator)
19454342 Polymorphisms of DARC has minimal impact on HIV disease progression.
19454342 Observational study of gene-disease association. (HuGE Navigator)
19454341 Lack of DARC has no influence on HIV disease progression in African population.
19454340 Expression of DARC has no effect on HIV-1 acquisition or progression to AIDS in African Americans.
19454339 DARC genotype is not associated with the progression of AIDS or risk for HIV acquisition.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19290478 Interest in DARC has risen as it has become a potential explanation for some of the differences in prognosis and presentation seen in those with African genealogy in diseases of inflammation and malignancy--REVIEW
19206111 Multiple myeloma patients show a variation in the phenotype of DARC protein.
19180233 Polymorphism in DARC is predictive of low neutrophil count in African Americans.
19180233 Observational study of gene-disease association. (HuGE Navigator)
19064726 Loss of red cell chemokine scavenging promotes transfusion-related lung inflammation
19060902 DARC internalized chemokines but did not effectively scavenge them.
19048480 Genetic polymorphisms in Duffy genes are not associated with malaria resistance in patients from Baixo Amazonas region, Brazil
19048480 Observational study of gene-disease association. (HuGE Navigator)
18827265 Susceptibility to asthma and atopy among certain populations of African descent is influenced by a functional polymorphism in the gene encoding Duffy antigen/receptor for chemokines
18827265 Observational study of gene-disease association. (HuGE Navigator)
18804827 Observational study of gene-disease association. (HuGE Navigator)
18710383 Observational study of gene-disease association. (HuGE Navigator)
18621010 DARC influences HIV/AIDS susceptibility by mediating trans-infection of HIV-1 and by affecting both chemokine-HIV interactions and chemokine-driven inflammation.
18608113 Observational study of genotype prevalence. (HuGE Navigator)
18510579 Observational study of genetic testing. (HuGE Navigator)
18460195 Observational study of genotype prevalence. (HuGE Navigator)
18248572 FY- status was strongly associated with chronic organ damage and proteinuria in sickle cell anemia
18248572 Observational study of gene-disease association. (HuGE Navigator)
18230715 These results suggest a novel mechanism by which DARC could modulate inflammatory responses to chemokines in vivo.
18093292 Observational study of gene-disease association. (HuGE Navigator)
18067501 Observational study of genetic testing. (HuGE Navigator)
17955335 DARC on endothelial cells attenuated the angiogenic activity by causing senescence
17880612 Anti-Fy(a) has the potential to lead to significant fetal hemolysis. AntiFy(a)guidelines developed are appropriate for ensitization are appropriate for pregnancies complicated by anti-Fy(a) alloimmunization
17416748 There is a genetic association between Darc gene polymorphism and bone mineral density in humans.
17382291 Seven DARC glycosylation variants were obtained & expressed in human K562 cells. three canonical sites are used for sugar attachment.
17073738 DARC is involved in accumulation of extravascular chemokines in endothelial cella[review]
16372020 crystal structure of the P. knowlesi DBL domain (Pkalpha-DBL), which binds to DARC (Duffy antigen receptor for chemokines) during invasion of human erythrocytes
15847654 Observational study of genetic testing. (HuGE Navigator)
15783300 Observational study of genotype prevalence. (HuGE Navigator)
15754970 Observational study of genotype prevalence. (HuGE Navigator)
15569072 Observational study of genotype prevalence. (HuGE Navigator)
15569072 Forty Caucasian and 130 donors of African ancestry were serologically Fy(b-); among these, the majority of the donors of African ancestry had FY*B with the GATA SNP, while the majority of Caucasians typing Fy(b-) had FY*B with 265 T/298 A SNPs.
15358176 human Duffy antigen binds selected inflammatory, but not homeostatic, chemokines and that this binding pattern is reflected by endothelial cells within inflamed and non-inflamed tissue
15327416 Observational study of gene-disease association. (HuGE Navigator)
15327416 susceptibility of African American recipients to acute rejection and to delayed allograft function was not associated with DARC alleles or genotype in kidney transplantation.
15214968 The expression of DARC in the context of NSCLC tumors may act as a chemokine decoy receptor and interferes with normal tumor growth and chemokine-induced tumor neovascularization.
12739041 Observational study of gene-disease association. (HuGE Navigator)
12734373 Duffy antigen has a role in enhancing leukocyte recruitment to sites of inflammation by facilitating movement of chemokines across the endothelium.
12697152 Vascular endothelial cells may induce Duffy protein to regulate leukocytes and/or chemokine trafficking
12160521 Duffy antigen may play a role at local level by binding locally produced chemokines in psoriasis vulgaris
11813069 Observational study of gene-disease association. (HuGE Navigator)
11753822 signature of directional selection on FY*O in sub-Saharan Africa; understanding the extent to which natural selection has also played a role in the extreme geographic differentiation of the other derived allele at this locus, FY*A
11730271 The Duffy promoter polymorphism was not disproportionately represented in persons with HIVAN (HIV nepthropathy) calling into question any significant role in the pathogenesis of HIVAN.
11446431 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSV      1 - 70
LGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSA     71 - 140
FAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATH    141 - 210
TVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ    211 - 280
ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS                  281 - 336
//

Text Mined References (128)

PMID Year Title
26320997 2015 Staphylococcus aureus Targets the Duffy Antigen Receptor for Chemokines (DARC) to Lyse Erythrocytes.
26096170 2015 Expression of Duffy antigen receptor for chemokines (DARC) is down-regulated in colorectal cancer.
26045366 2015 The role of Duffy antigen receptor for chemokines in keloids.
25900316 2015 Duffy blood group phenotype-genotype correlations using high-resolution melting analysis PCR and microarray reveal complex cases including a new null FY*A allele: the role for sequencing in genotyping algorithms.
25817587 2015 Correlation between 'ACKR1/DARC null' polymorphism and benign neutropenia in Yemenite Jews.
25647274 2015 Duffy antigen receptor genetic variant and the association with Interleukin 8 levels.
25582271 2015 Erythrocyte genotyping for transfusion-dependent patients at the Azienda Universitaria Policlinico of Naples.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24981451 2014 CXCL1 inhibits airway smooth muscle cell migration through the decoy receptor Duffy antigen receptor for chemokines.
24929836 2014 Frequencies of Duffy blood group alleles in Northern Pakistani donors.
24845979 2014 High-throughput Kell, Kidd, and Duffy matrix-assisted laser desorption/ionization, time-of-flight mass spectrometry-based blood group genotyping of 4000 donors shows close to full concordance with serotyping and detects new alleles.
24710306 2014 Duffy antigen receptor for chemokine (DARC) polymorphisms and its involvement in acquisition of inhibitory anti-duffy binding protein II (DBPII) immunity.
24415938 2014 Red blood cell invasion by Plasmodium vivax: structural basis for DBP engagement of DARC.
24260134 2013 Effect of genetic variants in two chemokine decoy receptor genes, DARC and CCBP2, on metastatic potential of breast cancer.
23820435 2013 Molecular characterization of the Fy(a-b-) phenotype in a Polish family.
23753024 2013 The effect of Duffy antigen receptor for chemokines on severity in sickle cell disease.
23462454 2013 Prognostic impact of atypical chemokine receptor expression in patients with gastric cancer.
23356288 2013 Atypical chemokine receptors: from silence to sound.
23347639 2013 High frequency of the erythroid silent Duffy antigen genotype and lack of Plasmodium vivax infections in Haiti.
23259672 2012 Plasmodium vivax infection in Anajás, State of Pará: no differential resistance profile among Duffy-negative and Duffy-positive individuals.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23224555 2012 Platelet factor 4 and Duffy antigen required for platelet killing of Plasmodium falciparum.
23168236 2013 DARC (Duffy) and BCAM (Lutheran) reduced expression in thyroid cancer.
23028857 2012 Natural selection mediated association of the Duffy (FY) gene polymorphisms with Plasmodium vivax malaria in India.
23017229 2012 Genome-wide association replicates the association of Duffy antigen receptor for chemokines (DARC) polymorphisms with serum monocyte chemoattractant protein-1 (MCP-1) levels in Hispanic children.
22912641 2012 Duffy antigen receptor for chemokines and its involvement in patterning and control of inflammatory chemokines.
22910367 2013 Impact of Duffy antigen receptor for chemokine gene expression on mandibular bone density in menopausal women.
22744181 2012 Bivariate genome-wide association study suggests that the DARC gene influences lean body mass and age at menarche.
22698181 2012 The biochemistry and biology of the atypical chemokine receptors.
22291609 2012 A genome-wide association scan on the levels of markers of inflammation in Sardinians reveals associations that underpin its complex regulation.
22207676 2012 The association between a Darc gene polymorphism and clinical outcomes in African American patients with acute lung injury.
22123959 2011 Fy(a)/Fy(b) antigen polymorphism in human erythrocyte Duffy antigen affects susceptibility to Plasmodium vivax malaria.
22097233 2011 The genetics of benign neutropenia.
22082243 2012 DARC alleles and Duffy phenotypes in African Americans.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
22037903 2012 Genetic variants associated with the white blood cell count in 13,923 subjects in the eMERGE Network.
21784153 2011 Evidence that erythrocyte DARC-positive phenotype can affect the GVHD occurrence after HLA-identical sibling HSCT.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
21156192 2011 A Duffy antigen receptor for chemokines (DARC) polymorphism that determines pro-fibrotic chemokine serum concentrations is not directly associated with severity of hepatitis C infection.
21151196 2011 DARC and D6: silent partners in chemokine regulation?
21088296 2011 Activation state of alpha4beta1 integrin on sickle red blood cells is linked to the duffy antigen receptor for chemokines (DARC) expression.
20664684 2010 Acquired antibody responses against Plasmodium vivax infection vary with host genotype for duffy antigen receptor for chemokines (DARC).
20655790 2010 Plasmodium vivax and the Duffy antigen: a paradigm revisited.
20655787 2010 Multiple interests in structural models of DARC transmembrane protein.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596779 2011 The Duffy Antigen/Receptor for Chemokines (DARC) and prostate-cancer risk among Jamaican men.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20560530 2010 Robust, high-throughput solution for blood group genotyping.
20431033 2010 Single PCR multiplex SNaPshot reaction for detection of eleven blood group nucleotide polymorphisms: optimization, validation, and one year of routine clinical use.
20373092 2010 Chemokine decoy receptors: structure-function and biological properties.
20347396 2010 Association between Duffy antigen receptor for chemokines expression and levels of inflammation markers in sickle cell anemia patients.
20231434 2010 Plasmodium vivax clinical malaria is commonly observed in Duffy-negative Malagasy people.
20199879 2010 Effect of interleukin-8 and RANTES on the Gardos channel activity in sickle human red blood cells: role of the Duffy antigen receptor for chemokines.
20162434 2010 FY polymorphisms and vivax malaria in inhabitants of Amazonas State, Brazil.
20040767 2010 Duffy antigen receptor for chemokines (Darc) polymorphism regulates circulating concentrations of monocyte chemoattractant protein-1 and other inflammatory mediators.
19927622 2009 Southeast Asian ovalocytosis is associated with increased expression of Duffy antigen receptor for chemokines (DARC).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19822078 Influence of the Duffy antigen on pharmacokinetics and pharmacodynamics of recombinant monocyte chemoattractant protein (MCP-1, CCL-2) in vivo.
19620399 2009 The Duffy-null state is associated with a survival advantage in leukopenic HIV-infected persons of African ancestry.
19454342 2009 Duffy antigen polymorphisms do not alter progression of HIV in African Americans in the MACS cohort.
19454341 2009 Lack of Duffy antigen receptor for chemokines: no influence on HIV disease progression in an African treatment-naive population.
19454340 2009 Expression of Duffy antigen receptor for chemokines (DARC) has no effect on HIV-1 acquisition or progression to AIDS in African Americans.
19454339 2009 The Duffy antigen receptor for chemokines null promoter variant does not influence HIV-1 acquisition or disease progression.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19290478 2009 Shedding light on DARC: the role of the Duffy antigen/receptor for chemokines in inflammation, infection and malignancy.
19206111 2009 High ratio of Duffy (a+b+) phenotype in patients with multiple myeloma compared to healthy controls.
19180233 2009 Reduced neutrophil count in people of African descent is due to a regulatory variant in the Duffy antigen receptor for chemokines gene.
19064726 2009 Loss of red cell chemokine scavenging promotes transfusion-related lung inflammation.
19060902 2009 The Duffy antigen receptor for chemokines transports chemokines and supports their promigratory activity.
19048480 2008 Genetic polymorphisms in TLR4, CR1 and Duffy genes are not associated with malaria resistance in patients from Baixo Amazonas region, Brazil.
18827265 2008 Gene encoding Duffy antigen/receptor for chemokines is associated with asthma and IgE in three populations.
18804827 2009 Plasmodium vivax circumsporozoite variants and Duffy blood group genotypes in the Brazilian Amazon region.
18710383 2008 Duffy (Fy), DARC, and neutropenia among women from the United States, Europe and the Caribbean.
18621010 2008 Duffy antigen receptor for chemokines mediates trans-infection of HIV-1 from red blood cells to target cells and affects HIV-AIDS susceptibility.
18608113 Duffy blood group system genotyping in an urban Tunisian population.
18510579 2008 Introduction of a real-time-based blood-group genotyping approach.
18460195 2008 Distribution of the FYBES and RHCE*ce(733C>G) alleles in an Argentinean population: implications for transfusion medicine.
18248572 2008 Lack of Duffy antigen expression is associated with organ damage in patients with sickle cell disease.
18230715 2008 The duffy antigen/receptor for chemokines exists in an oligomeric form in living cells and functionally antagonizes CCR5 signaling through hetero-oligomerization.
18179887 2008 Admixture mapping of white cell count: genetic locus responsible for lower white blood cell count in the Health ABC and Jackson Heart studies.
18093292 2007 Duffy blood group gene polymorphisms among malaria vivax patients in four areas of the Brazilian Amazon region.
18067501 2008 Blood group genotyping for Jk(a)/Jk(b), Fy(a)/Fy(b), S/s, K/k, Kp(a)/Kp(b), Js(a)/Js(b), Co(a)/Co(b), and Lu(a)/Lu(b) with microarray beads.
17955335 2007 Duffy antigen/receptor for chemokines (DARC) attenuates angiogenesis by causing senescence in endothelial cells.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17880612 2007 Management of pregnancies complicated by anti-Fy(a) alloimmunization.
17416748 2007 Identification of mouse Duffy antigen receptor for chemokines (Darc) as a BMD QTL gene.
17389925 2007 Reduced Plasmodium vivax erythrocyte infection in PNG Duffy-negative heterozygotes.
17382291 2007 Mutational analysis of the N-glycosylation sites of Duffy antigen/receptor for chemokines.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17073738 2006 Throwing light on DARC.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16372020 2006 Structural basis for Duffy recognition by the malaria parasite Duffy-binding-like domain.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15783300 2005 ABO, Rh, MNS, Duffy, Kidd,Yt, Scianna, and Colton blood group systems in indigenous Chinese.
15754970 2004 Genetic characterization of the population of Grande Comore Island (Njazidja) according to major blood groups.
15569072 2004 A novel FY allele in Brazilians.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358176 2004 The human Duffy antigen binds selected inflammatory but not homeostatic chemokines.
15327416 2004 Duffy antigen receptor and genetic susceptibility of African Americans to acute rejection and delayed function.
15214968 2004 Overexpression of the duffy antigen receptor for chemokines (DARC) by NSCLC tumor cells results in increased tumor necrosis.
13679391 2003 A high endothelial venule-expressing promiscuous chemokine receptor DARC can bind inflammatory, but not lymphoid, chemokines and is dispensable for lymphocyte homing under physiological conditions.
12956774 2003 Structure-function analysis of the extracellular domains of the Duffy antigen/receptor for chemokines: characterization of antibody and chemokine binding sites.
12739041 2003 Polymorphism of the Duffy erythrocyte chemokine receptor in Italian patients with Behçet's disease.
12734373 2003 Duffy antigen facilitates movement of chemokine across the endothelium in vitro and promotes neutrophil transmigration in vitro and in vivo.
12697152 2003 Induction of Duffy gene (FY) in human endothelial cells and in mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12160521 2002 The role of the Duffy antigen-related chemokine receptor in psoriasis vulgaris.
12081195 2002 Expression of the duffy antigen/receptor for chemokines (DARC) by the inflamed synovial endothelium.
11813069 Duffy blood group genotypes among malaria patients in Rondônia, Western Brazilian Amazon.
11446431 2001 Duffy antigen/receptor for chemokines (DARC): genotypes in Ashkenazi and non-Ashkenazi Jews in Israel.
10570183 1999 Emergence of FY*A(null) in a Plasmodium vivax-endemic region of Papua New Guinea.
9921412 1998 Binding of HIV-1 to RBCs involves the Duffy antigen receptors for chemokines (DARC).
9886340 1998 The Fy(x) phenotype is associated with a missense mutation in the Fy(b) allele predicting Arg89Cys in the Duffy glycoprotein.
9746760 1998 A novel mutation in the coding sequence of the FY*B allele of the Duffy chemokine receptor gene is associated with an altered erythrocyte phenotype.
9731074 1998 Arg89Cys substitution results in very low membrane expression of the Duffy antigen/receptor for chemokines in Fy(x) individuals.
9195930 1997 Close association of the first and fourth extracellular domains of the Duffy antigen/receptor for chemokines by a disulfide bond is required for ligand binding.
9058825 1997 Expression of chemokine receptors by subsets of neurons in the central nervous system.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8542025 1995 Duffy and receptors for P. vivax and chemotactic peptides.
8248172 1993 Cloning of glycoprotein D cDNA, which encodes the major subunit of the Duffy blood group system and the receptor for the Plasmodium vivax malaria parasite.
7833467 1995 Genomic organization of the glycoprotein D gene: Duffy blood group Fya/Fyb alloantigen system is associated with a polymorphism at the 44-amino acid residue.
7705836 1995 Molecular basis and PCR-DNA typing of the Fya/fyb blood group polymorphism.
7689250 1993 A receptor for the malarial parasite Plasmodium vivax: the erythrocyte chemokine receptor.
7663520 1995 Disruption of a GATA motif in the Duffy gene promoter abolishes erythroid gene expression in Duffy-negative individuals.
7592830 1995 The promiscuous chemokine binding profile of the Duffy antigen/receptor for chemokines is primarily localized to sequences in the amino-terminal domain.
7517217 1994 Functional and biochemical analysis of the cloned Duffy antigen: identity with the red blood cell chemokine receptor.
2892777 1988 The Duffy blood group is linked to the alpha-spectrin locus in a large pedigree with autosomal dominant inheritance of Charcot-Marie-Tooth disease type 1.
16148 1977 [AH8165, a new muscle relaxant].