Property Summary

NCBI Gene PubMed Count 177
PubMed Score 2343.40
PubTator Score 4664.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.814 1.7e-07
posterior fossa group A ependymoma -1.800 3.0e-07
atypical teratoid/rhabdoid tumor -1.800 6.7e-05
sonic hedgehog group medulloblastoma -1.700 5.1e-03
pilocytic astrocytoma 1.200 1.4e-02
pituitary cancer 1.500 3.2e-05
dermatomyositis -1.300 3.3e-03

 GWAS Trait (1)

 CSPA Cell Line (3)

Protein-protein Interaction (5)

Gene RIF (136)

PMID Text
26494253 Report acetylcholinesterase kinetics using fluorogenic probe for the investigation of free thiols.
26369587 Data suggest membranes of erythrocytes of patients with chronic obstructive pulmonary disease exhibit the following changes: increase in acetylcholinesterase; decrease in total ATPases and Na+/K+-ATPases; increase in lipid peroxidation/oxidative stress.
26299326 Phosphorylated p38, DNMT1 and AChE were aberrantly expressed in a subset of hepatocellular carcinoma tumors.
26210933 Report reactivation kinetics of a large series of bispyridinium oximes with organophosphate-inhibited human acetylcholinesterase.
26202430 Data suggest cholinesterase inhibitors with high potency have proper conformation in active site of ACHE and interact with key residues (Trp84, Phe330 at catalytic anionic site; Trp279 at peripheral anionic site; Gly118, Gly119, Ala201 at oxyanion hole.
26200596 Case Report: repetitive obidoxime treatment induced increase of red blood cell acetylcholinesterase activity even in a late phase of a severe methamidophos poisoning.
26051873 PRX-105 is a plant-derived recombinant version of the human 'read-through' acetylcholinesterase splice variant (AChE-R) which may be used for treatment/prevention of organophosphate poisoning.
26002584 These results suggest that the low AChE activity observed in larynx squamous cell carcinoma may be useful for predicting the outcome of patients.
25956553 Low AChE activity in head and neck squamous cell carcinoma can be used to predict survival in patients with head and neck cancer.
25919665 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25766324 The results suggest that interference with the enzymatic activities of AChE and/or interference with necroptosis may be novel approaches to influence ovarian functions.
25240585 Data suggest that natural antisense RNA may play an important role in acetylcholinesterase (AChE) regulation via affecting the epigenetic modification in the AChE promoter region.
25240274 In symptomatic methylphosphonic difluoride poisoning high methylphosphonofluoridic acid concentrations in blood/tissues may lead to the formation of toxic phosphonyloximes after treatment with oximes.
25239202 QSAR analysis on tacrine-related acetylcholinesterase inhibitors.
24905476 Data show that the 3D-quantitative structure property relationship (QSAR) models are capable of explaining the experimental phenomenon of ligand recognition and binding to acetylcholinesterase (AChE).
24594013 The results showed that AChE clusters colocalized with neurexin assemblies in the neurites of hippocampal neurons.
24402754 The mesenteric lymphatic vessels show many AChE positive nerve fibres around their wall with an almost plexiform distribution.
24249815 Low AChE activity was associated with deficits in neurodevelopment, particularly in attention, inhibition, and memory in boys but not in girls.
23981668 Results suggest that AChE 7-20, a beta-hairpin region in AChE, might be a new motif in AChE capable of triggering Abeta aggregation and deposition
23974008 Synaptic acetylcholinesterase may be a tumor suppressor and is modulated by miR-212 in non-small cell lung cancer.
23936791 The aim of this work is to review and discuss the recent findings about acetylcholinesterase, including its sensitivity to other pollutants and the expression of different splice variants.
23897820 AChE is regulated in two neuronal cell lines by APP in a manner independent of the generation of sAPPalpha, sAPPbeta, and AICD.
23748235 There is decreased expression of ACHE and CHRM3 in eccrine glands of cholinergic urticaria patients.
23711548 the T14 peptide derived from AChE produced a dose-dependent biphasic modulation of cortical networks activity dependent on the alpha-nAChR: study of a novel bioactive agent of high potential relevance to neurodegenerative disorders such as Alzheimer disease
23625910 toxicogenetics/genetic association study in population in Turkey: Data suggest SNP in PON1 (192Q/R) is associated with susceptibility to organophosphate poisoning; plasma ACHE activities of exposed workers vary w/ PON1 genotype: 192RR>192QR>192QQ.
23466605 Data indicate that high AChE affinity of the compounds was achieved by optimizing different substituents on the pyridazinone ring, without sacrificing the AChE/BuChE selectivity profile.
23440190 Free energy landscape for the binding process of Huperzine A to acetylcholinesterase
23119107 Acetylcholinesterase inhibitor huperazine A improved, or partly reversed, the Abeta-induced damage of neurite outgrowth.
23072732 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
23063927 verify amplification and/or deletion in the ACHE, BCHE, EPHB4 and MME genes in 32 samples of sporadic breast cancer
23047027 AChE contains a deep active site gorge with two sites of ligand binding, an acylation site (or A-site) containing the catalytic triad at the base of the gorge and a peripheral site (or P-site) near the gorge entrance.
23047022 assayed the relative activities of AChE and BChE in membrane fractions and culture medium of three different neuronal cell lines, namely the neuroblastoma cell lines SH-SY5Y and NB7 and the basal forebrain cell line SN56
22805525 results suggest that the glycosylation may affect AChE(H) enzymatic activity and trafficking, but not dimer formation. The present findings indicate the significance of N-glycosylation in controlling the biosynthesis of the AChE(H) dimer form
22560633 AChE and BChE activities were decreased in prostate cancer patients
22142546 AChE may have a role in Alzheimer's Disease; its inhibitors are designed for Alzheimer's treatment
21795704 The N-linked glycosylation of AChE(T) plays a major role for acquisition of AChE full enzymatic activity but does not affect its oligomerization.
21730071 Oxime-assisted acetylcholinesterase catalytic scavengers of organophosphates that resist aging
21621296 AChE knockdown with small interfering (si)RNA also decreases presenilin-1 levels, while AChE overexpression exerts an opposing effect.
21576115 Low plasma AChE activity can be a useful candidate biomarker to identify subjects at greater risk of developing postoperative delirium.
21530001 Overexpression of mutant hyperphosphorylated tau (P-tau) leads to an increase in activity of AChE in the brain of transgenic mice.
21493754 certain SNPs in ACHE gene correlated with catalytic properties and cardiovascular functions; identified 19 SNPs; allelic and haplotype variations in ACHE associated with changes in blood AChE activities; AChE activity was associated with BP status and SBP
21473860 The AChE the A allele was found significantly more frequent in patients than in controls (0.437 vs. 0.332; p=0.002).
21377978 The activation of the Akt cascade abolished the 55 kDa protein, and both AChE protein forms (68 and 55 kDa) accumulated in the nucleus during apoptosis.
21274871 Acetylcholinesterase, a key prognostic predictor for hepatocellular carcinoma, suppresses cell growth and induces chemosensitization.
20964587 The increased maternal AChE and Na(+), K(+)-ATPase activities may be due to the low total antioxidant status determined post vaginal delivery, whereas their decreased activities in prematures to their immaturity.
20883446 Data show that kidney and renal tumours showed comparable levels of acetylcholinesterase mRNA, the content of butyrylcholinesterase mRNA was increased 10-fold in pRCC.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20433814 differences between human and guinea pig AChE
20431033 Observational study of genetic testing. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20398640 the structure-reaction rate correlations for the hydrolysis of the set of neutral esters in the active site of acetylcholinesterase
20356562 Surgical pieces of prostatic cancer (PC) and benign prostatic hyperplasia (BPH) were analyzed for AChE and BChE activity.
20338155 AChE appears to be a potential therapeutic target at muscle injuries including organophosphate myopathy.
20193849 The majority of the tumor tissues showed a notable number of both deletions and amplifications: 65.7% and 22.9%, respectively, in BCHE and 45.7% and 31.4%, respectively, in ACHE. Deletion of the ACHE gene sig correlated with amp'n of ERBB2.
20173328 The data of this study suggested the N-AChE-S, AChE-S and AChE-R variants of AChE play distinct role in Alzheimer's disease.
20156100 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
20138030 a novel peptide sequence which blocks access to the active-site gorge in the crystal structure of recombinant human acetylcholinesterase
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912576 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19730683 Observational study of gene-disease association. (HuGE Navigator)
19468687 Data suggest that Smad3 can regulate acetylcholinesterase transcriptional activation following calcium-induced nuclear accumulation.
19371631 Toxicodynamic analysis of the inhibition of isolated human acetylcholinesterase by combinations of methamidophos and methomyl in vitro.
19371630 Toxicodynamic analysis of the combined cholinesterase inhibition by paraoxon and methamidophos in human whole blood.
19327769 findings clearly establish an association between homozygosity for the DD allele of the ACHE gene and risk for recurrent pregnancy loss in women from northern India
19327769 Observational study of gene-disease association. (HuGE Navigator)
19294450 Data conclude that an erythrocyte G protein with subunits Galphai1/2 and Gbeta is associated with band 3. AChE depends on the degree of band 3 phosphorylation and its association with Galphai1/2 and Gbeta.
19185568 These results suggest that AChE activity was altered in acute lymphoblastic leukemia patients.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19051205 The development of AChE-like catalytic activity in anti-AChE antibodies appears to be the result of a combination of structural complementarity to a substrate-binding site, charge complementarity to a salt bridge, and specific structural peculiarities.
19019080 Differences between the t peptides of Aacetylcholinesterase and butyrylcholinesterase are conserved among all vertebrates.
18780301 SNPs of AChE, BChE, and ChAT genes do not seem to play a relevant role in the response to treatment with the two cholinesterase inhibitors donepezil and rivastigmine.
18780301 Observational study of gene-disease association. (HuGE Navigator)
18769671 N-acetylcholinesterase has a role in apoptosis in Alzheimer's disease
18612832 Acetylcholinesterase supports anchorage independence in colon cancer.
18470725 Results show that acetylcholinesterase (AChE) activity and RNA levels increase during differentiation, and that differentiation of intestinal cells involves AChE-induced cell cycle arrest.
18454940 During a normal delivery process, the increased levels of catecholamines and the increased AChE activity, post-delivery, may be due to the increased stress of delivery.
18344198 Determne in vitro oxime protection of human red blood cell acetylcholinesterase inhibited by diisopropyl-fluorophosphate.
18299393 PS1 can interact with AChE and influence its expression, supporting the notion of cholinergic-amyloid interrelationships.
18258603 Interactions of AChE with caveolin-1 and subsequently with cytochrome c appear to be indispensable for apoptosome formation in a colon cancer cell line.
18215127 define sites for the interaction of AChE and laminin and suggest that the interaction plays a role in cell adhesion
18194455 ACHE increases spermatozoan apoptosis but enhances sperm motility.
18161504 Testing potency of acetylcholinesterase reactivators.
17984143 Genotoxic biomarkers and AChE levels are important parameters for determining effects of pesticide exposure on health.
17948252 These findings suggest that cell surface AChE, possibly in a novel signalling complex containing APP and perlecan, contributes to a generalised mechanism for polarised membrane protrusion and migration in all adherent cells.
17729290 Computational and biochemical approaches have been combined to shed light on the atomic aspects of the role of Li(+), Na(+), and K(+) on human acetylcholinesterase (hAChE) ligand binding
17702992 Report concentration-dependent interactions of chlorpyrifos oxon with acetylcholinesterase.
17606622 that the 55-kDa AChE may be involved in different biological processes such as neural development, tumor progression, and angiogenesis.
17503475 Observational study of gene-disease association. (HuGE Navigator)
17503475 AChE polymorphisms do not constitute a major genetic risk factor for susceptibility to Alzheimer's diseasein a Sardinian population.
17476278 AChE's 3' alternative splicing, and the corresponding changes in AChE-S/CtBP interactions, thus emerge as being actively involved in controlling hematopoiesis
17370251 Combination of obidoxime and HI6 reactivated AChE inhibited by a range of cholinesterase inhibitors.
17335779 calcium-activated butyrylcholinesterase as a major protective mechanism against suicide inhibition of AchE by organophosphates in this non-neuronal tissue
17320203 These results indicate that calcineurin mediates acetylcholinesterase expression during apoptosis.
17272501 Modified AChE gene expression and properties are causally involved in thymic function and development.
17192673 Asingle ACHE gene produces several types of catalytic subunits by alternative splicing, but a single splice variant, called type T (AChET), is expressed in adult mammalian muscle and brain
17192630 Levels of AChE, its molecular forms, and glycosylation in the cerebrospinal fluid (CSF) from Creutzfeldt-Jakob disease (CJD) patients differs from normal values.
17192624 relationship between the expression of AChE and the aggressiveness in tumors.
16996687 These results indicate that cortical acetylcholineesterase activity is relatively well preserved in apolipoprotein E4 carriers, either by preservation of its cellular expression or as AChE activity in amyloid plaques.
16909200 Down-regulation of Acetylcholinesterase is associated with colorectal carcinoma
16832351 Upregulation of acetylcholinesterase is associated with ovarian cancer
16801396 These findings suggest that the Polyethyleneglycol conjugated (PEGylated) recombinant human acetylcholinesterase exhibits unaltered biodistribution and high bioavailability.
16516310 Variant-specific causal involvement of AChE in the progression of both neurodegenerative diseases and neuromuscular syndromes raises the possibility that future therapeutic drugs might target specific AChE variant(s) or the corresponding RNA transcripts.
16429485 expression level of acetylcholinesterase was increased in lung cancer
16375580 Increased membrane AChE activity may be due to high homocysteine levels
16262697 demonstration of the existence of a membrane-bound acetylcholinesterase in human endothelial cells
16256968 functional and molecular design of the AChE active center
16256091 basal lamina formation is the essential event in the transformation of immature neuromuscular contact into differentiated neuromuscular junction, with the accumulation of not only muscular but also neuronal AChE in the synaptic cleft
16213467 Human plasma contains four esterases: butyrylcholinesterase, paraoxonase, acetylcholinesterase, and albumin.
15974920 Observational study of genotype prevalence. (HuGE Navigator)
15974894 Variations were observed in expression of mRNA for presenilin-1, which was highest in singly transgenic hAChE mice, and the stress-inducible form of AChE, which was elevated when both transgenes were present.
15783300 Observational study of genotype prevalence. (HuGE Navigator)
15715671 Observational study of gene-gene interaction. (HuGE Navigator)
15690550 Observational study of gene-disease association. (HuGE Navigator)
15629887 findings suggest that inherited interactive weakness of acetylcholinesterase and paraoxonase 1 expression increases the insecticide-induced occurrence of Parkinson's disease
15488495 This study found a layer 3 magnopyramidal AChERN left-right size asymmetry restricted to Brodmann's area 45, a component of Broca's language area.
15459952 Observational study of genotype prevalence. (HuGE Navigator)
15459952 A total of 13 ACHE SNPs were identified, 10 of which are newly described, and five that should produce amino acid substitutions
15454088 AChE is involved in regulating cell-matrix interactions in bone
15161650 complexed with abeta protein, is toxic to rat brain beta-amyloid aggregation, laminin expression, reactive astrocytosis, and neuronal cell loss.
15123727 Data suggest that alternative promoter usage combined with alternative splicing may lead to stress-dependent combinatorial complexity of acetylcholinesterase mRNA transcripts and their protein products.
15078872 analysis of acetylcholinesterase near the active center gorge
15060281 Observational study of gene-disease association. (HuGE Navigator)
14766237 oxidation of AchE by hydrogen peroxide contributes significantly to the well-established oxidative stress in vitiligo
12963741 muscle-induced neuronal AChE expression in co-culture is mediated by a cAMP-dependent signaling
12928915 Observational study of gene-disease association. (HuGE Navigator)
12851386 analysis of acetylcholinesterase active site
12811800 AChE was predominantly expressed in neurons of the anterodorsal, midline, ventral, intralaminar, and reticular nuclei.
12548360 AChE activity in the CSF of Alzeimer's disease patients is affected differentially by different AChE inhibitors. (AChE)
12466963 complex regulation of its gene expression in brain tumors
12140295 regulation of ACHE expression in developing muscle cells
12081473 The aromatic "trapping" of the catalytic histidine is essential for efficient catalysis
12069617 REVIEW: Simulations show how breathing motions in the enzyme facilitate the displacement of substrate from the surface of the enzyme to the buried active site; such motions suggest possible modes of regulation of the activity of the enzyme.
12009429 serum and erythrocyte membrane enzyme inhibited by antidepressants, fluoxetine, sertraline and amitriptyline, in a dose related manner

AA Sequence

MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAE      1 - 70
PPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPT     71 - 140
SPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLA    141 - 210
LQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRAT    211 - 280
QLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG    281 - 350
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE    351 - 420
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL    421 - 490
DPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQAC    491 - 560
AFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL                    561 - 614
//

Text Mined References (183)

PMID Year Title
26494253 2016 A novel fluorogenic probe for the investigation of free thiols: Application to kinetic measurements of acetylcholinesterase activity.
26369587 2015 Oxidative stress and damage to erythrocytes in patients with chronic obstructive pulmonary disease--changes in ATPase and acetylcholinesterase activity.
26299326 2015 Anticancer drugs induce hypomethylation of the acetylcholinesterase promoter via a phosphorylated-p38-DNMT1-AChE pathway in apoptotic hepatocellular carcinoma cells.
26210933 2016 Investigation of the reactivation kinetics of a large series of bispyridinium oximes with organophosphate-inhibited human acetylcholinesterase.
26202430 2015 Development of 3D-QSAR Model for Acetylcholinesterase Inhibitors Using a Combination of Fingerprint, Molecular Docking, and Structure-Based Pharmacophore Approaches.
26200596 2016 Repetitive obidoxime treatment induced increase of red blood cell acetylcholinesterase activity even in a late phase of a severe methamidophos poisoning: A case report.
26051873 2015 Preclinical and first-in-human evaluation of PRX-105, a PEGylated, plant-derived, recombinant human acetylcholinesterase-R.
26002584 2015 Unbalanced acetylcholinesterase activity in larynx squamous cell carcinoma.
25956553 2015 Dysregulated cholinergic network as a novel biomarker of poor prognostic in patients with head and neck squamous cell carcinoma.
25766324 2015 Readthrough acetylcholinesterase (AChE-R) and regulated necrosis: pharmacological targets for the regulation of ovarian functions?
25240585 2014 A natural antisense transcript regulates acetylcholinesterase gene expression via epigenetic modification in Hepatocellular Carcinoma.
25240274 2014 Reactions of methylphosphonic difluoride with human acetylcholinesterase and oximes--Possible therapeutic implications.
25239202 2014 QSAR analysis on tacrine-related acetylcholinesterase inhibitors.
24905476 2015 Quantifying ligand-receptor interactions for gorge-spanning acetylcholinesterase inhibitors for the treatment of Alzheimer's disease.
24594013 2014 Interaction of acetylcholinesterase with neurexin-1? regulates glutamatergic synaptic stability in hippocampal neurons.
24402754 2013 Cholinergic innervation of human mesenteric lymphatic vessels.
24249815 2013 Acetylcholinesterase activity and neurodevelopment in boys and girls.
23981668 2014 A new motif in the N-terminal of acetylcholinesterase triggers amyloid-? aggregation and deposition.
23974008 2013 Synaptic acetylcholinesterase targeted by microRNA-212 functions as a tumor suppressor in non-small cell lung cancer.
23936791 2013 Acetylcholinesterase as a biomarker in environmental and occupational medicine: new insights and future perspectives.
23897820 2013 The amyloid precursor protein represses expression of acetylcholinesterase in neuronal cell lines.
23748235 2014 Decreased expression of acetylcholine esterase in cholinergic urticaria with hypohidrosis or anhidrosis.
23711548 2013 High-resolution spatio-temporal bioactivity of a novel peptide revealed by optical imaging in rat orbitofrontal cortex in vitro: possible implications for neurodegenerative diseases.
23679855 2013 Crystal structures of human cholinesterases in complex with huprine W and tacrine: elements of specificity for anti-Alzheimer's drugs targeting acetyl- and butyryl-cholinesterase.
23625910 2015 Effect of paraoxonase 1 192 Q/R polymorphism on paraoxonase and acetylcholinesterase enzyme activities in a Turkish population exposed to organophosphate.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23466605 2013 Discovery of novel 2,6-disubstituted pyridazinone derivatives as acetylcholinesterase inhibitors.
23440190 2013 Free energy landscape for the binding process of Huperzine A to acetylcholinesterase.
23119107 2012 The protection of acetylcholinesterase inhibitor on ?-amyloid-induced the injury of neurite outgrowth via regulating axon guidance related genes expression in neuronal cells.
23063927 2013 Copy number variation in ACHE/EPHB4 (7q22) and in BCHE/MME (3q26) genes in sporadic breast cancer.
23047027 2013 Hydrolysis of low concentrations of the acetylthiocholine analogs acetyl(homo)thiocholine and acetyl(nor)thiocholine by acetylcholinesterase may be limited by selective gating at the enzyme peripheral site.
23047022 2013 Characterisation of acetylcholinesterase release from neuronal cells.
23035744 2012 Structures of human acetylcholinesterase in complex with pharmacologically important ligands.
22990020 2012 Genome-wide association study for circulating levels of PAI-1 provides novel insights into its regulation.
22805525 2012 N-linked glycosylation of dimeric acetylcholinesterase in erythrocytes is essential for enzyme maturation and membrane targeting.
22560633 2012 Cholinesterase activities and biochemical determinations in patients with prostate cancer: influence of Gleason score, treatment and bone metastasis.
22142546 2012 AChE inhibitor: a regio- and stereo-selective 1,3-dipolar cycloaddition for the synthesis of novel substituted 5,6-dimethoxy spiro[5.3']-oxindole-spiro-[6.3?]-2,3-dihydro-1H-inden-1?-one-7-(substituted aryl)-tetrahydro-1H-pyrrolo[1,2-c][1,3]thiazole.
21795704 2011 The assembly of proline-rich membrane anchor (PRiMA)-linked acetylcholinesterase enzyme: glycosylation is required for enzymatic activity but not for oligomerization.
21730071 2011 Oxime-assisted acetylcholinesterase catalytic scavengers of organophosphates that resist aging.
21621296 2012 Changes in acetylcholinesterase expression are associated with altered presenilin-1 levels.
21576115 2011 Low preoperative plasma cholinesterase activity as a risk marker of postoperative delirium in elderly patients.
21530001 2012 Altered expression of brain acetylcholinesterase in FTDP-17 human tau transgenic mice.
21493754 2011 Naturally occurring variations in the human cholinesterase genes: heritability and association with cardiovascular and metabolic traits.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
21473860 2011 Variation of the butyrylcholinesterase (BChE) and acetylcholinesterase (AChE) genes in coronary artery disease.
21377978 2011 Induction of a 55 kDa acetylcholinesterase protein during apoptosis and its negative regulation by the Akt pathway.
21274871 2011 Acetylcholinesterase, a key prognostic predictor for hepatocellular carcinoma, suppresses cell growth and induces chemosensitization.
20964587 2010 Erythrocyte membrane AChE, Na(+), K(+)-ATPase and Mg(2+) ATPase activities in mothers and their premature neonates in relation to the mode of delivery.
20883446 2010 Expression of cholinesterases in human kidney and its variation in renal cell carcinoma types.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20433814 2010 Comparison of human and guinea pig acetylcholinesterase sequences and rates of oxime-assisted reactivation.
20431033 2010 Single PCR multiplex SNaPshot reaction for detection of eleven blood group nucleotide polymorphisms: optimization, validation, and one year of routine clinical use.
20408548 2010 Structural evidence that human acetylcholinesterase inhibited by tabun ages through O-dealkylation.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20398640 2010 Correlation between the substrate structure and the rate of acetylcholinesterase hydrolysis modeled with the combined quantum mechanical/molecular mechanical studies.
20356562 2010 Analysis of cholinesterases in human prostate and sperm: implications in cancer and fertility.
20338155 2010 Acetylcholinesterase is involved in apoptosis in the precursors of human muscle regeneration.
20193849 2010 Amplification and deletion of the ACHE and BCHE cholinesterase genes in sporadic breast cancer.
20173328 2010 Acetylcholinesterase variants in Alzheimer's disease: from neuroprotection to programmed cell death.
20138030 2010 Acetylcholinesterase: from 3D structure to function.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19468687 2009 Calcium signaling-induced Smad3 nuclear accumulation induces acetylcholinesterase transcription in apoptotic HeLa cells.
19371631 2009 Toxicodynamic analysis of the inhibition of isolated human acetylcholinesterase by combinations of methamidophos and methomyl in vitro.
19371630 2009 Toxicodynamic analysis of the combined cholinesterase inhibition by paraoxon and methamidophos in human whole blood.
19327769 2009 Acetylcholinesterase gene polymorphism and recurrent pregnancy loss.
19294450 2009 Modulation of erythrocyte acetylcholinesterase activity and its association with G protein-band 3 interactions.
19185568 2009 Changes in acetylcholinesterase (AchE) activity in lymphocytes and whole blood in acute lymphoblastic leukemia patients.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19051205 Investigations into the development of catalytic activity in anti-acetylcholinesterase idiotypic and anti-idiotypic antibodies.
19019080 2009 Respective roles of the catalytic domains and C-terminal tail peptides in the oligomerization and secretory trafficking of human acetylcholinesterase and butyrylcholinesterase.
18780301 2009 Variability of AChE, BChE, and ChAT genes in the late-onset form of Alzheimer's disease and relationships with response to treatment with Donepezil and Rivastigmine.
18769671 2008 N-acetylcholinesterase-induced apoptosis in Alzheimer's disease.
18612832 2008 Acetylcholinesterase supports anchorage independence in colon cancer.
18470725 2008 Acetylcholinesterase in intestinal cell differentiation involves G2/M cell cycle arrest.
18457821 2008 Rational design of a drug for Alzheimer's disease with cholinesterase inhibitory and neuroprotective activity.
18454940 2008 The effect of the mode of delivery on the maternal-neonatal erythrocyte membrane acetylcholinesterase activity.
18344198 2008 In vitro oxime protection of human red blood cell acetylcholinesterase inhibited by diisopropyl-fluorophosphate.
18299393 2008 Presenilin 1 interacts with acetylcholinesterase and alters its enzymatic activity and glycosylation.
18258603 2008 Interactions of acetylcholinesterase with caveolin-1 and subsequently with cytochrome c are required for apoptosome formation.
18215127 2008 Interaction of acetylcholinesterase with the G4 domain of the laminin alpha1-chain.
18194455 2008 Acetylcholinesterase-R increases germ cell apoptosis but enhances sperm motility.
18161504 2008 Potency of novel oximes to reactivate sarin inhibited human cholinesterases.
17984143 2007 Determination of AChE levels and genotoxic effects in farmers occupationally exposed to pesticides.
17948252 2008 Morphoregulation by acetylcholinesterase in fibroblasts and astrocytes.
17729290 2008 The role of Li+, Na+, and K+ in the ligand binding inside the human acetylcholinesterase gorge.
17702992 2007 Concentration-dependent binding of chlorpyrifos oxon to acetylcholinesterase.
17606622 2007 Expression and subcellular localization of a novel nuclear acetylcholinesterase protein.
17503475 2007 Alzheimer's disease: case-control association study of polymorphisms in ACHE, CHAT, and BCHE genes in a Sardinian sample.
17476278 2007 Acetylcholinesterase/C terminal binding protein interactions modify Ikaros functions, causing T lymphopenia.
17370251 Reactivation of organophosphate-inhibited human AChE by combinations of obidoxime and HI 6 in vitro.
17335779 2007 Calcium-activated butyrylcholinesterase in human skin protects acetylcholinesterase against suicide inhibition by neurotoxic organophosphates.
17320203 2007 Calcineurin mediates acetylcholinesterase expression during calcium ionophore A23187-induced HeLa cell apoptosis.
17272501 2007 The thymic theme of acetylcholinesterase splice variants in myasthenia gravis.
17192673 2006 Transcriptional control of different acetylcholinesterase subunits in formation and maintenance of vertebrate neuromuscular junctions.
17192630 2006 Altered glycosylation of acetylcholinesterase in the Creutzfeldt-Jakob cerebrospinal fluid.
17192624 2006 Acetyl- and butyrylcholinesterase activities decrease in human colon adenocarcinoma.
16996687 2006 Cortical acetylcholine esterase activity and ApoE4-genotype in Alzheimer disease.
16909200 2006 Cholinesterases are down-expressed in human colorectal carcinoma.
16832351 2007 Differentially androgen-modulated genes in ovarian epithelial cells from BRCA mutation carriers and control patients predict ovarian cancer survival and disease progression.
16801396 2006 Comparison of polyethylene glycol-conjugated recombinant human acetylcholinesterase and serum human butyrylcholinesterase as bioscavengers of organophosphate compounds.
16516310 2006 Virtues and woes of AChE alternative splicing in stress-related neuropathologies.
16429485 2005 Acetylcholinesterase biogenesis is impaired in lung cancer tissues.
16375580 2006 Erythrocyte membrane acetylcholinesterase activity in subjects with MTHFR 677C-->T genotype.
16289501 2005 Acetylcholinesterase and molecular interactions at the neuromuscular junction.
16262697 2005 Biochemical characterization of human umbilical vein endothelial cell membrane bound acetylcholinesterase.
16256968 2005 Functional requirements for the optimal catalytic configuration of the AChE active center.
16256091 2005 Expression and distribution of acetylcholinesterase among the cellular components of the neuromuscular junction formed in human myotube in vitro.
16213467 2005 Butyrylcholinesterase, paraoxonase, and albumin esterase, but not carboxylesterase, are present in human plasma.
15974920 2005 Analysis of genetic polymorphisms in acetylcholinesterase as reflected in different populations.
15974894 2005 Memory deficits correlating with acetylcholinesterase splice shift and amyloid burden in doubly transgenic mice.
15783300 2005 ABO, Rh, MNS, Duffy, Kidd,Yt, Scianna, and Colton blood group systems in indigenous Chinese.
15715671 2005 Inherited and acquired interactions between ACHE and PON1 polymorphisms modulate plasma acetylcholinesterase and paraoxonase activities.
15690550 2005 Candidate gene association studies of genes involved in neuronal cholinergic transmission in Alzheimer's disease suggests choline acetyltransferase as a candidate deserving further study.
15629887 2005 Acetylcholinesterase/paraoxonase interactions increase the risk of insecticide-induced Parkinson's disease.
15526038 2004 The synaptic acetylcholinesterase tetramer assembles around a polyproline II helix.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488495 2004 AChE-rich magnopyramidal neurons have a left-right size asymmetry in Broca's area.
15474030 2004 Mouse acetylcholinesterase interacts in yeast with the extracellular matrix component laminin-1beta.
15459952 2004 A paradigm for single nucleotide polymorphism analysis: the case of the acetylcholinesterase gene.
15454088 2004 Characterization of acetylcholinesterase expression and secretion during osteoblast differentiation.
15161650 2004 Acetylcholinesterase-Abeta complexes are more toxic than Abeta fibrils in rat hippocampus: effect on rat beta-amyloid aggregation, laminin expression, reactive astrocytosis, and neuronal cell loss.
15123727 2004 Combinatorial complexity of 5' alternative acetylcholinesterase transcripts and protein products.
15078872 2004 Nanosecond dynamics of acetylcholinesterase near the active center gorge.
15060281 2004 Acetylcholinesterase/paraoxonase genotype and expression predict anxiety scores in Health, Risk Factors, Exercise Training, and Genetics study.
14766237 2004 Activation/deactivation of acetylcholinesterase by H2O2: more evidence for oxidative stress in vitiligo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963741 2003 Muscle induces neuronal expression of acetylcholinesterase in neuron-muscle co-culture: transcriptional regulation mediated by cAMP-dependent signaling.
12928915 2003 Association study between Alzheimer's disease and genes involved in Abeta biosynthesis, aggregation and degradation: suggestive results with BACE1.
12853948 2003 The DNA sequence of human chromosome 7.
12851386 2003 Inhibitors tethered near the acetylcholinesterase active site serve as molecular rulers of the peripheral and acylation sites.
12811800 2003 Differential distribution of butyrylcholinesterase and acetylcholinesterase in the human thalamus.
12769797 2003 Role of acetylcholinesterase inhibitors in the metabolism of amyloid precursor protein.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12609505 2003 Two novel mutations in the COLQ gene cause endplate acetylcholinesterase deficiency.
12604711 2003 Adenosine A1 receptor agonist N6-cyclopentyladenosine affects the inactivation of acetylcholinesterase in blood and brain by sarin.
12548360 2002 Cerebrospinal fluid levels of biomarkers and activity of acetylcholinesterase (AChE) and butyrylcholinesterase in AD patients before and after treatment with different AChE inhibitors.
12524166 2003 Human acetylcholinesterase binds to mouse laminin-1 and human collagen IV by an electrostatic mechanism at the peripheral anionic site.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466963 2002 Complex regulation of acetylcholinesterase gene expression in human brain tumors.
12427014 2002 Amyloid fibril formation by a synthetic peptide from a region of human acetylcholinesterase that is homologous to the Alzheimer's amyloid-beta peptide.
12140295 2002 A cyclic AMP-dependent pathway regulates the expression of acetylcholinesterase during myogenic differentiation of C2C12 cells.
12081473 2002 The aromatic "trapping" of the catalytic histidine is essential for efficient catalysis in acetylcholinesterase.
12069617 2002 Molecular dynamics of acetylcholinesterase.
12009429 2002 Antidepressants inhibit human acetylcholinesterase and butyrylcholinesterase activity.
11985878 2002 Increased expression of intranuclear AChE involved in apoptosis of SK-N-SH cells.
11804574 2002 PRiMA: the membrane anchor of acetylcholinesterase in the brain.
11799248 2002 Alternative splicing and neuritic mRNA translocation under long-term neuronal hypersensitivity.
11283752 2001 Acetylcholinesterase--new roles for an old actor.
11239002 2001 Comparative analysis of the gene-dense ACHE/TFR2 region on human chromosome 7q22 with the orthologous region on mouse chromosome 5.
11053835 2000 Structures of recombinant native and E202Q mutant human acetylcholinesterase complexed with the snake-venom toxin fasciculin-II.
11002295 2000 Muscular dystrophy alters the processing of light acetylcholinesterase but not butyrylcholinesterase forms in liver of Lama2(dy) mice.
10837146 2000 Negative regulation of selected bHLH proteins by eHAND.
10800960 2000 Hydrophobic protein that copurifies with human brain acetylcholinesterase: amino acid sequence, genomic organization, and chromosomal localization.
9847074 1998 Toward a complete human genome sequence.
9811904 1998 Functional redundancy of acetylcholinesterase and neuroligin in mammalian neuritogenesis.
9689136 1998 Human endplate acetylcholinesterase deficiency caused by mutations in the collagen-like tail subunit (ColQ) of the asymmetric enzyme.
9640563 1997 External and internal electrostatic potentials of cholinesterase models.
9579781 1998 Infracortical interstitial cells concurrently expressing m2-muscarinic receptors, acetylcholinesterase and nicotinamide adenine dinucleotide phosphate-diaphorase in the human and monkey cerebral cortex.
8488842 1993 Mutation at codon 322 in the human acetylcholinesterase (ACHE) gene accounts for YT blood group polymorphism.
8460160 1993 Expression of a human acetylcholinesterase promoter-reporter construct in developing neuromuscular junctions of Xenopus embryos.
8449945 1993 Tissue-specific expression and alternative mRNA processing of the mammalian acetylcholinesterase gene.
8349597 1993 Dissection of the human acetylcholinesterase active center determinants of substrate specificity. Identification of residues constituting the anionic site, the hydrophobic site, and the acyl pocket.
8299725 1994 Expression of three alternative acetylcholinesterase messenger RNAs in human tumor cell lines of different tissue origins.
8280063 1993 N-glycosylation of human acetylcholinesterase: effects on activity, stability and biosynthesis.
8248502 1993 Promoter elements and alternative splicing in the human ACHE gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7836436 1995 Contribution of aromatic moieties of tyrosine 133 and of the anionic subsite tryptophan 86 to catalytic efficiency and allosteric modulation of acetylcholinesterase.
7085778 1982 Brain ligatin: a membrane lectin that binds acetylcholinesterase.
3954986 1986 Fractional diffusion-limited component of reactions catalyzed by acetylcholinesterase.
3319614 1987 Modes of attachment of acetylcholinesterase to the surface membrane.
2734315 1989 Coamplification of human acetylcholinesterase and butyrylcholinesterase genes in blood cells: correlation with various leukemias and abnormal megakaryocytopoiesis.
2714437 1989 Purification and partial amino acid sequence analysis of human erythrocyte acetylcholinesterase.
2263619 1990 Molecular cloning and construction of the coding region for human acetylcholinesterase reveals a G + C-rich attenuating structure.
1748670 1991 The effect of elimination of intersubunit disulfide bonds on the activity, assembly, and secretion of recombinant human acetylcholinesterase. Expression of acetylcholinesterase Cys-580----Ala mutant.
1744105 1991 Gene structure of mammalian acetylcholinesterase. Alternative exons dictate tissue-specific expression.
1609795 1992 The human gene encoding acetylcholinesterase is located on the long arm of chromosome 7.
1517212 1992 Mutagenesis of human acetylcholinesterase. Identification of residues involved in catalytic activity and in polypeptide folding.
1391965 1992 Evidence that the antigens of the Yt blood group system are located on human erythrocyte acetylcholinesterase.
1380483 1992 Mapping the human acetylcholinesterase gene to chromosome 7q22 by fluorescent in situ hybridization coupled with selective PCR amplification from a somatic hybrid cell panel and chromosome-sorted DNA libraries.