Property Summary

Ligand Count 1,885
NCBI Gene PubMed Count 189
PubMed Score 2470.47
PubTator Score 4664.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.8e-02
atypical teratoid/rhabdoid tumor -1.800 6.7e-05
dermatomyositis -1.300 3.3e-03
ependymoma -1.600 3.2e-06
group 4 medulloblastoma 1.300 5.9e-03
osteosarcoma -2.814 1.7e-07
pituitary cancer 1.500 3.2e-05

 CSPA Cell Line (3)

PDB (24)

Gene RIF (147)

AA Sequence

MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAE      1 - 70
PPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPT     71 - 140
SPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLA    141 - 210
LQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRAT    211 - 280
QLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG    281 - 350
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE    351 - 420
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPL    421 - 490
DPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQAC    491 - 560
AFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL                    561 - 614
//

Text Mined References (195)

PMID Year Title