Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.83
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (6)

AA Sequence

MGAPHWWDQLQAGSSEVDWCEDNYTIVPAIAEFYNTISNVLFFILPPICMCLFRQYATCFNSGIYLIWTL      1 - 70
LVVVGIGSVYFHATLSFLGQMLDELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLA     71 - 140
FVKPAINNISLMTLGVPCTALLIAELKRCDNMRVFKLGLFSGLWWTLALFCWISDRAFCELLSSFNFPYL    141 - 210
HCMWHILICLAAYLGCVCFAYFDAASEIPEQGPVIKFWPNEKWAFIGVPYVSLLCANKKSSVKIT         211 - 275
//

Text Mined References (11)

PMID Year Title