Property Summary

NCBI Gene PubMed Count 2,328
PubMed Score 29360.39
PubTator Score 16082.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 6.82336988394219E-17
lung adenocarcinoma 2714 1.13298479946563E-10
facioscapulohumeral dystrophy 286 0.0400980987635232
Disease Target Count
Kidney failure 41
Renal dysplasia 4

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer -1.692 0.000
lung adenocarcinoma -1.500 0.000
facioscapulohumeral dystrophy 1.800 0.040

Synonym

Accession P12821 B0LPF0 B4DXI3 E7EU16 P22966 Q53YX9 Q59GY8 Q7M4L4 ACE
Symbols DCP
ACE1
DCP1
CD143

Gene

ACE

PDB

4APH   1O86   1O8A   1UZE   1UZF   2C6F   2C6N   2IUL   2IUX   2OC2   2XY9   2XYD   2YDM   3BKK   3BKL   3L3N   3NXQ   4APJ   4BXK   4BZR   4BZS   4C2N   4C2O   4C2P   4C2Q   4C2R   4CA5   4CA6   4UFA   4UFB   5AM8   5AM9   5AMA   5AMB   5AMC  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (2793)

PMID Text
27340988 With regard to the ACE I/D polymorphism, there was no significant difference in genotype and allele frequencies between the patient group and control group.
27096746 The peptide qf-Abeta(12-18)C (sequence VHHQKLVC) was cleaved by multiple Abeta-degrading enzymes, including NEP, ACE, and ECE-1, whereas the redesigned peptide qf-Abeta(12-16)AAC (sequence VHHQKAAC) was sensitive to NEP and ACE only.
27089712 The ACE indel mutations and eNOS 894 G > T polymorphism are risk factors in patients with acute coronary syndrome and myocardial infarction.
27082637 the genotype of ACE I/D and the D allele are associated with autism
27075997 ACTN3 and ACE genotypes influence sprint time in elite male athletes; No genotype differences were detected in sprint performance in both Caucasian and African ancestry sprinters
27022914 high levels of PAI-1 are detected when D allele is present, whereas greater interdialytic gain is associated with the presence of I allele.
26982073 observations imply a genetically modulated role for ACE in control of glucose import and oxidation in working skeletal muscle
26978018 The morphologically normal tissue adjacent to the tumor shows the substantial expression of MMP-2 and MMP-9 and in some cases the enhanced activity of uPA and ACE, which makes an additional contribution to the increased invasive potential of tumor
26884824 ACE rs4309 SNP may be related to the incidence of Alzheimer's disease in a Hunan Han Chinese population.
26847099 In patients with sarcoidosis, sACE levels can be used to better define those who would benefit from FDG-PET/CT examination to detect extrathoracic involvement.
More...

AA Sequence

MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQVLFQSVAASWA      1 - 70
HDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRIIGAVRTLGSANLPLAKRQQY     71 - 140
NALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTAL    141 - 210
SNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAH    211 - 280
LLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEK    281 - 350
PADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI    351 - 420
GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNF    421 - 490
DWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEGPLHQCDIY    491 - 560
RSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKYFQPVTQWLQEQNQQNGEVLGWPEYQWHP    561 - 630
PLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKY    631 - 700
GTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDL    701 - 770
TNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER    771 - 840
LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAM    841 - 910
LKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNL    911 - 980
EDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDIN    981 - 1050
FLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIP   1051 - 1120
SSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQP   1121 - 1190
NMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW   1191 - 1260
LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS                           1261 - 1306
//

Text Mined References (2337)

PMID Year Title
27340988 2016 Angiotensin-Converting Enzyme (ACE) I/D and Alpha-Adducin (ADD1) G460W Gene Polymorphisms in Turkish Patients with Severe Chronic Tinnitus.
27096746 2016 Design of Peptide Substrate for Sensitively and Specifically Detecting Two A?-Degrading Enzymes: Neprilysin and Angiotensin-Converting Enzyme.
27089712 [GENES ALLELE STATUS OF ANGIOTENSINCONVERTING ENZYME (I/D) AND ENDOTHELIAL NITRIC OXIDE SYNTHASE (894 G > T) IN PATIENTS WITH ACUTE CORONARY SYNDROME].
27082637 2016 Genetic Variants of Angiotensin-Converting Enzyme Are Linked to Autism: A Case-Control Study.
27075997 2016 ACTN3 R577X and ACE I/D gene variants influence performance in elite sprinters: a multi-cohort study.
27022914 2016 Influence of ACE I/D Polymorphism on Circulating Levels of Plasminogen Activator Inhibitor 1, D-Dimer, Ultrasensitive C-Reactive Protein and Transforming Growth Factor ?1 in Patients Undergoing Hemodialysis.
26982073 2016 The Angiotensin Converting Enzyme Insertion/Deletion Polymorphism Modifies Exercise-Induced Muscle Metabolism.
26978018 [Matrix metalloproteinases 2 and 9, their endogenous regulators, and angiotensin-converting enzyme in cervical squamous cell carcinoma].
26884824 2015 Relationship between the gene polymorphisms of kallikrein-kinin system and Alzheimer's disease in a Hunan Han Chinese population.
26847099 2016 Angiotensin-converting Enzyme as a Predictor of Extrathoracic Involvement of Sarcoidosis.
More...