Property Summary

NCBI Gene PubMed Count 54
PubMed Score 246.51
PubTator Score 78.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
gastric carcinoma 1.200 3.6e-02
osteosarcoma -1.754 2.9e-07
subependymal giant cell astrocytoma -1.624 8.1e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (24)

AA Sequence

MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWA      1 - 70
PAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDV     71 - 140
GATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFS    141 - 210
LLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQEHQGALVCLAESCLT    211 - 280
LEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLT    281 - 350
LIASPPSSPSSSGTPALPGHMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICSAPATLTPRSPHAS    351 - 420
RTPSSPLQSCTPSLSPRSHVPSPHQALVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGAQEPCSVWEP    421 - 490
PKRHRDGSAFQYEYEPPCTSLCARVQAVRLPPQLMAWALHFLMDAQPGSEPTPM                    491 - 544
//

Text Mined References (65)

PMID Year Title