Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.01
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Narcolepsy 72 3.12 1.6

Expression

 Compartment GO Term (2)

AA Sequence

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED      1 - 70
ATSAYISKAKELIEKYGI                                                         71 - 88
//

Text Mined References (5)

PMID Year Title