Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.36
PubTator Score 26.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.100 1.4e-02
Breast cancer 2.500 2.7e-02
dermatomyositis 1.700 1.8e-04
ductal carcinoma in situ 1.100 2.0e-02
intraductal papillary-mucinous adenoma (... 2.000 2.2e-04
intraductal papillary-mucinous carcinoma... 1.900 2.6e-04
intraductal papillary-mucinous neoplasm ... 1.200 4.4e-02
Multiple myeloma 1.441 5.7e-03
osteosarcoma 3.545 6.7e-10
ovarian cancer 1.600 7.1e-05
psoriasis 1.400 2.2e-02
ulcerative colitis 1.100 7.8e-03

Gene RIF (20)

AA Sequence

MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAE      1 - 70
EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGN     71 - 140
DRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKE    141 - 210
EEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL    211 - 280
QEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE    281 - 350
PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF    351 - 420
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEE    421 - 490
VYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR                                    491 - 528
//

Text Mined References (40)

PMID Year Title