Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.75
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.7e-11
ovarian cancer 8520 1.0e-07
Pick disease 1894 4.4e-06
Atopic dermatitis 952 3.7e-04
atypical teratoid / rhabdoid tumor 5112 6.7e-04
oligodendroglioma 2850 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis 1.300 3.7e-04
atypical teratoid / rhabdoid tumor -1.300 6.7e-04
ependymoma -1.500 4.7e-11
oligodendroglioma 1.400 2.3e-02
ovarian cancer -1.200 1.0e-07
Pick disease -2.200 4.4e-06

Gene RIF (3)

AA Sequence

MTVEFEECVKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQG      1 - 70
DTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKEDVRKFKETKKQFDKVREDLELSLVRNA     71 - 140
QAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQAKKKFEILDSMLSFMHAQSSFFQQGYSLLHQ    141 - 210
LDPYMKKLAAELDQLVIDSAVEKREMERKHAAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRAS    211 - 280
NAFKTWNRRWFSIQNSQLVYQKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCMLQADSEKL    281 - 350
RQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVLQRVQSVAGNSQCGD    351 - 420
CGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAVNQIYEAQCEGA    421 - 490
GSRKPTASSSRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRVQKCLRPHSSPRAPTARRKVRLEPVL    491 - 560
PCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAGAGPRSLSSDSGLGGSSDGSSDVLAFGSGSV    561 - 630
VDSVTEEEGAESEESSGEADGDTEAEAWGLADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAE    631 - 700
DEGKTPLVQAVLGGSLIVCEFLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQR    701 - 770
DPLAIAVQAANADIVTLLRLARMAEEMREAEAAPGPPGALAGSPTELQFRRCIQEFISLHLEES          771 - 834
//

Text Mined References (9)

PMID Year Title