Property Summary

NCBI Gene PubMed Count 23
PubMed Score 15.18
PubTator Score 16.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 2.8e-03
osteosarcoma -4.579 2.6e-07
glioblastoma -1.200 2.1e-04
medulloblastoma, large-cell -1.500 3.0e-04
autosomal dominant Emery-Dreifuss muscul... -1.043 2.5e-02
juvenile dermatomyositis -1.123 6.8e-09
Amyotrophic Lateral Sclerosis -1.076 1.1e-04
Atopic dermatitis 1.200 2.7e-03
tuberculosis 1.200 1.2e-05
interstitial cystitis 1.900 1.3e-03
adult high grade glioma -1.200 2.6e-03
atypical teratoid/rhabdoid tumor -1.100 3.6e-04
group 4 medulloblastoma -1.400 8.7e-04

Gene RIF (15)

PMID Text
25502766 The serum lever of Alzheimer's disease were decrease and the expression of ACAP1 strongly correlated with the Mini-Mental State Examination scores of the AD patients
25496667 Genome-wide shRNA screening identifies CENTB1/ACAP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25225293 ACAP1 and ARAP2 each colocalize with Arf6 but they did not colocalize with each other and have opposing effects on focal adhesions.
23317930 CENTB1 was up-regulated in patients with active UC as compared to UC remission and healthy control groups suggesting that it is involved in the inflammatory process.
22645133 phosphorylation of ACAP1 relieves a localized mechanism of autoinhibition in regulating cargo binding
22188517 the oncogenic potential of USP6 is linked to its ability to integrate cell migration and cytokinesis by regulating Arf6/ACAP1.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18003747 ACAP1 has robust, constitutive Arf6 GAP activity in vivo, with little activity toward Arf1.
17664335 Results suggest that ACAP1, a GTPase-activating protein (GAP) for ADP-ribosylation factor (ARF) 6, is part of a novel clathrin coat complex that is regulated by ARF6 for endocytic recycling in two key physiological settings.
17010122 Results suggest that two ARF6 downstream molecules, PIP5K and ACAP1, function together in endosomal tubulation and that phosphoinositide levels may regulate endosomal dynamics.
17005562 CENTB1 selectively down-regulates NF-kappaB activation via NODs pathways, creating a "feedback" loop and suggesting a novel role of CENTB1 in innate immune responses to bacteria and inflammatory responses
15525538 ACAP1 promotes endocytic recycling by recognizing recycling sorting signals.
11062263 Centaurin beta1/KIAA0050, or ACAP1, is a phospholipid dependent, ARF6 preferring GTPase-activating protein. It can regulate cytoskeletal and membrane trafficking events in the cell periphery and may be regulated via a phosphoinositide-binding PH domain.
11050434 Centaurin beta1/KIAA0050, is a member of the centaurin family of ADP-ribosylation factor directed GTPase-activating proteins. Binding of phosphoinositides to a pleckstrin homology domain may regulate subcellular localisation and activity.

AA Sequence

MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFVVGICDLARLG      1 - 70
PPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTH     71 - 140
NAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEEL    141 - 210
SRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAF    211 - 280
KTWSRRWFTIQSNQLVYQKKYKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQL    281 - 350
WVSAVQSSIASAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC    351 - 420
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVIINQIYEARVE    421 - 490
AMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQPPVPPKPSIRPRPGSLRSKPE    491 - 560
PPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLIQATAANSLLACEFLLQNG    561 - 630
ANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREA    631 - 700
EAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL                                  701 - 740
//

Text Mined References (27)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25502766 2015 Translational study of Alzheimer's disease (AD) biomarkers from brain tissues in A?PP/PS1 mice and serum of AD patients.
25284369 2014 A PH domain in ACAP1 possesses key features of the BAR domain in promoting membrane curvature.
25225293 2014 The Arf6 GTPase-activating proteins ARAP2 and ACAP1 define distinct endosomal compartments that regulate integrin ?5?1 traffic.
23317930 2013 Gene and protein expression of centaurin beta 1 (CENTB1) are up-regulated in patients with ulcerative colitis.
22645133 2012 Mechanistic insights into regulated cargo binding by ACAP1 protein.
22188517 2012 The oncogenic TBC domain protein USP6/TRE17 regulates cell migration and cytokinesis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
18003747 2008 Substrate specificities and activities of AZAP family Arf GAPs in vivo.
17664335 2007 An ACAP1-containing clathrin coat complex for endocytic recycling.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17398097 2007 Regulation of Arf6 and ACAP1 signaling by the PTB-domain-containing adaptor protein GULP.
17010122 2006 Cooperation of phosphoinositides and BAR domain proteins in endosomal tubulation.
17005562 2006 Centaurin beta1 down-regulates nucleotide-binding oligomerization domains 1- and 2-dependent NF-kappaB activation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16777052 2006 Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry.
16256741 2005 Phosphorylation of ACAP1 by Akt regulates the stimulation-dependent recycling of integrin beta1 to control cell migration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15525538 2004 ACAP1 promotes endocytic recycling by recognizing recycling sorting signals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11062263 2000 ACAPs are arf6 GTPase-activating proteins that function in the cell periphery.
11050434 2000 Cytohesins and centaurins: mediators of PI 3-kinase-regulated Arf signaling.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.