Property Summary

NCBI Gene PubMed Count 119
PubMed Score 1961.40
PubTator Score 150.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

 GWAS Trait (2)

Gene RIF (94)

PMID Text
26943656 Citrullinated Proteoglycan Aggrecan is a new member of citrullinated proteins identified in human joints.
25741789 Idiopathic short stature is due to novel heterozygous mutation of the aggrecan gene.
25715982 Identification of homozygous deletion in ACAN and other candidate variants in familial classical Hodgkin lymphoma by exome sequencing.
25603412 ACAN positive perineuronal nets and glial cells were decreased in the amygdala of szhizophrenia and bipolar disorder patients compared to controls.
25188217 An underlying interaction between aggrecan VNTR and obesity in symptomatic lumbar disc herniation.
25173489 Data show there was no significant difference in the aggrecan (ACAN) rs1516797 genotype or allele distributions between the carpal tunnel syndrome (CTS) and control groups.
24766640 results suggested that genetic variants in ACAN and MET are associated with HM. Functional roles of ACAN and MET in the development of HM need to be further investigated
24762113 Heterozygous mutations in ACAN can cause a mild skeletal dysplasia, which presents clinically as short stature with advanced bone age.
24552666 The results suggest that regions within ACAN is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties.
24421874 SHOX2, like SHOX, regulates NPPB directly whilst activates ACAN via its cooperation with the SOX trio.
24398992 The expression of growth differentiation factor 5 (GDF5) and aggrecan in 15 cases of salivary gland pleomorphic adenomas, was investigated.
24312401 PKCepsilon activation in late passage NP cells may represent a molecular basis for aggrecan availability, as part of an PKCepsilon/ERK/CREB/AP-1-dependent transcriptional program that includes upregulation of both chondrogenic genes and microRNAs
24296484 significant increased risks were found among Asians with shorter alleles of Aggrecan
24111521 ROCKi decreased the association between ETS-1 and its binding sites on the MMP-3 promoter, whereas ROCKi promoted the interaction between SOX9 and the AGN promoter.
24063364 microRNA-140 targets RALA and regulates chondrogenic differentiation of human mesenchymal stem cells by translational enhancement of SOX9 and ACAN.
24032649 the subsequent presentation of aggregan from ECM leads to CD4(+) T-cell activation and effector cell formation.
23897278 ADAMTS-4_v1 is expressed as a protein in vivo in human osteoarthritis synovium, functions as an aggrecanase, and cleaves other proteoglycan substrates.
23370687 Data indicate link protein peptide (LPP) upregulates expression of aggrecan and collagen II at both mRNA and protein levels.
23237500 The total mole fraction of unelongated xylose residues per aggrecan was significantly less (p = 0.03) after IL-1beta treatment compared to control cultures.
23209686 aggrecan alleles with shorter VNTR length have a role in intervertebral disc degeneration, while VDR (TaqI, FokI, ApaI) gene polymorphisms do not [meta-analysis]
22820679 Identification of enhancer sequences involved in the regulation of expression of the human ACAN gene.
22670872 Data suggest that matrix metalloproteinases are mainly involved in normal aggrecan turnover in extracellular matrix and may have less-active roles in aggrecan degradation during knee injury or osteoarthritis (where aggrecanase-1 has central role).
22441960 The reduction in keratan sulfate levels and the strong correlation between chondroitin 6-sulfate and keratan sulfate levels indi-cates suppressed cartilage turnover after arthroscopic surgery.
22329809 The concentration of aggrecan, biglycan, and decorin was determined in six regions of the human supraspinatus tendon.
22297263 In the CNS, aggrecan is expressed in a precise and tightly regulated manner both temporally and spatially. (Review)
22241609 Increased expression of collagen II, aggrecan, and cartilage oligomeric matrix protein (COMP), were observed during differentiation of induced pluripotent stem cells from osteoarthritic chondrocytes.
22015197 Yiqi Huayu Bushen Recipe increased the expression of aggrecan, decreased the expression of type X collagen, and promoted cell proliferation in cells from degenerated human intervertebral discs.
21948754 In Turkish population, short repeated alleles of the aggrecan gene are associated with increased disc degeneration and disc herniation.
21689646 The objective of the present study was to assess the immunolocalization of aggrecan in the annulus, and to assess molecular gene expression patterns in the annulus extracellular matrix.
21655647 This study tests the hypothesis that disease severity is characterized by alterations in expression of cartilage-specific genes for aggrecan and collagen type II.
21277254 The cell-specific production rate of MIA was quantitatively proportional to the aggrecan gene expression level in the early and middle phase of cartilage chondrocyte differentiation.
21224775 Data show that a molecular complex of fibronectin and aggrecan predicts response to lumbar ESI for radiculopathic back pain with HNP.
21117903 Confocal immunostaining demonstrated colocalization of m-calpain and the aggrecan product within the lower hypertrophic chondrocytes and in limited region of the pericellular matrix.
21039430 Observational study of gene-disease association. (HuGE Navigator)
20936487 Carrying a copy of the aggrecan allele with 21 repeats may increase the risk of multiple disc degeneration in subjects less than 40 years of age.
20936487 Observational study of gene-disease association. (HuGE Navigator)
20806220 The sstructure of an unglycosylated 30 kDa peptide from the chondroitin sulphate (CS)-attachment region of human aggrecan (CS-peptide), which was predicted to be intrinsically disordered was compared with the adjacent aggrecan G3 domain.
20640910 analysis of interleukin-6, vascular endothelial growth factor, YKL-40, matrix metalloproteinase-3, and total aggrecan in spondyloarthritis patients during 3 years of treatment with TNFalpha inhibitors
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618160 Data indicate that calpains are involved in the C-terminal truncation of aggrecan and might have a minor role in arthritic diseases.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20505571 Data show an association between the distribution of aggrecan gene VNTR polymorphism and the expression of aggrecan in symptomatic LDH.
20505571 Observational study of gene-disease association. (HuGE Navigator)
20496110 Carrying shorter AGC1 alleles with less than 24 repeats could predispose a subject to lumbar disk degeneration disease in northern Iran.
20496110 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20367178 This study revealed that the polymorphisms of the VDR and aggrecan genes are associated with disc degeneration and herniation.
20367118 An underlying additive and multiplicative interaction is observed between the aggrecan gene VNTR polymorphism and smoking in symptomatic disc degeneration of Chinese Han in northern China.
20367118 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20137779 A genome-wide linkage analysis identified aggrecan (ACAN) as a prime candidate gene for the osteochondritis dissecans.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19893584 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19790048 Hypoxia not only induces type II collagen and aggrecan, but it also inhibits type I and type III collagen in the hypoxia-inducible factor 1alpha-dependent redifferentiation of chondrocytes.
19669783 The aggrecan was prominently immunolocalised in the cartilaginous vertebral body rudiments and to a lesser extent within the foetal intervertebral disc.
19657146 A novel HtrA1-susceptible cleavage site within the interglobular domain (IGD) of aggrecan was identified.
19545413 Levels of aggrecan ARGS fragments in human synovial fluid are increased in arthritis, osteoarthritis and following knee injury.
19333097 Application of both mechanical loads resulted in significant alterations of gene expression of PTN (+67%, P = 0.004 in anulus cells; +29%, P = 0.03 in nucleus cells) and aggrecan (+42%, P = 0.03 in anulus cells, -25%, P = 0.03 in nucleus cells).
19298220 Results indicate that CCN2/CTGF binds to aggrecan through its N-terminal IGFBP and VWC modules, and this binding may be related to the CCN2/CTGF-enhanced production and secretion of aggrecan by chondrocytes.
19294492 Aggrecan was deposited in the myxoid and chondroid stroma of salivary pleomorphic adenomas.
19266077 Observational study of gene-disease association. (HuGE Navigator)
19220578 in the human cerebral cortex, discrete, layer-specific PNNs are assembled through the participation of selected aggrecan isoforms that characterize defined subsets of cortical neurons
19180518 Observational study of gene-disease association. (HuGE Navigator)
19110214 There is a significant role for the aggrecan C-type lectin domain in regulating endochondral ossification and, thereby, height.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
19004047 there was an association between the aggrecan gene variable number of tandem repeats polymorphism and rheumatoid arthritis
19004047 Observational study of gene-disease association. (HuGE Navigator)
18829133 The number of aggrecan-based perineural nets in the parietal cortex of transgenic mice is not significantly reduced when compared to the wild-type. There is a loss of hyaluronan and aggrecan components in the amyloid plaque core and coronal zone.
18391952 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18055126 we conclude from the region-specific patterns that the aggrecan-based extracellular matrix is adapted to the fast processing of sensorimotor activities
18040638 mRNAs for type II collagen and aggrecan were expressed by MSCs treated with either TGFbeta1 or OP-1; however, substantial matrix production was not induced.
17632389 Observational study of gene-disease association. (HuGE Navigator)
17632389 The findings provide additional support for the role of the aggrecan gene VNTR polymorphism in intervertebral disc degeneration.
17588949 COMP/TSP5 may function to support matrix interactions with aggrecan in cartilage extracellular matrix
17568421 Human cells cultured over 5 days increased expression of aggrecan and collagen II in both nucleus and annulus cells under increasing osmolarity.
17308074 HIV-Tat peptide interferes with polyamine uptake via competition for proteoglycan binding sites rather than a putative downstream transporter in human carcinoma cells
17261541 Results show an aggrecan product with the COOH terminal neoepitope VPGVA is synthesized by intracellular processing in chondrocytes; M-calpain is the major candidate of the proteinase to generate this product during intracellular aggrecan processing.
16741449 Observational study of gene-disease association. (HuGE Navigator)
16741449 Despite the negative association reported here, further investigation of the gene and its potential association to familial idiopathic scoliosis is required.
16650460 This study demonstrates that elevated aggrecan expression and its secretion are aberrant features of Hutchinson-Gilford Progeria Syndrome.
16574327 the cleavage of aggregable aggrecan occurred in concrete peptide bonds within the CS-1 and CS-2 attachment domains
16537531 establishing directly the relative residence time of these molecules in human intervertebral disc matrix
16425147 relationship between aggrecan structure and function; role of polymorphism in intervertebral disc and articular cartilage degeneratin [review]
16402214 Observational study of gene-disease association. (HuGE Navigator)
16402214 variable number of tandem repeat polymorphism of the aggrecan gene in 227 HTLV-I associated myelopathy/tropical spastic paraparesis patients, in 217 HTLV-I-infected healthy carriers, and in 85 normal controls
16080123 A mutation in the variable repeat region of the aggrecan gene (AGC1) causes a form of spondyloepiphyseal dysplasia associated with severe, premature osteoarthritis.
16001263 Data demonstrate a significant reduction of collagens I, II and aggrecan mRNA after the initiation of culture compared with mRNA levels in fresh tissue.
15590670 peptide fingerprinting showed that cartilage link protein and AG1 interact in the absence or presence of hyaluronan
14724283 the interaction between aggrecan and hyaluronan in cartilage is stabilized by Link protein
14722076 alternative splicing in the aggrecan G3 domain may be a mechanism for modulating interactions and extracellular matrix assembly
14627072 The amount of aggrecan may be related to motor aspects of intermittent exotropia
14558103 Peptide p135H, corresponding to the peptide sequence in the G3 domain of human cartilage proteoglycan aggrecan, is immunogenic/arthritogenic in BALB/c mice
12054629 cleaved by ADAMTS1 and diffrenteially inhibited by metalloproteinase inhibitors
11932252 Cleavage of the carboxyl tail from the G3 domain of aggrecan but not versican and identification of the amino acids involved in the degradation
11898616 no correlation between the number of tandem repeats and scoliosis severity

AA Sequence

MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLA      1 - 70
PRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIE     71 - 140
DSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVR    141 - 210
YPIHTPREGCYGDKDEFPGVRTYGIRDTNETYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARL    211 - 280
ATTGHVYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYT    281 - 350
GEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF    351 - 420
APEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYS    421 - 490
LTFEEAQQACPGTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCVGDKDSSPGVRTYGV    491 - 560
RPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCESHNATATTGQLYAAWSRGLDKCYAGWLADGS    561 - 630
LRYPIVTPRPACGGDKPGVRTVYLYPNQTGLPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWI    631 - 700
VTQVVPGVAAVPVEEETTAVPSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAETEES    701 - 770
TEGPSATEVPSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEEP    771 - 840
YTPSPPEPSWTELPSSGEESGAPDVSGDFTGSGDVSGHLDFSGQLSGDRASGLPSGDLDSSGLTSTVGSG    841 - 910
LTVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSGEVLETSASGVGDLSGLPSGEV    911 - 980
LETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISG    981 - 1050
LPSGEVLETTAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPG   1051 - 1120
VEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVL   1121 - 1190
ETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGLPSGEVLETAAPGVEDISGL   1191 - 1260
PSGEVLETAAPGVEDISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVDEISGLPSGEVLETTAPGV   1261 - 1330
EEISGLPSGEVLETSTSAVGDLSGLPSGGEVLEISVSGVEDISGLPSGEVVETSASGIEDVSELPSGEGL   1331 - 1400
ETSASGVEDLSRLPSGEEVLEISASGFGDLSGVPSGGEGLETSASEVGTDLSGLPSGREGLETSASGAED   1401 - 1470
LSGLPSGKEDLVGSASGDLDLGKLPSGTLGSGQAPETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSG   1471 - 1540
FPTVSLVDSTLVEVVTASTASELEGRGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDV   1541 - 1610
SGEIPGLFGVSGQPSGFPDTSGETSGVTELSGLSSGQPGVSGEASGVLYGTSQPFGITDLSGETSGVPDL   1611 - 1680
SGQPSGLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVELSGLPSGEADL   1681 - 1750
SGKSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAEIGSSLPSGAYYGSGTPSSFPTVS   1751 - 1820
LVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMSGEHSGFLDLSGLQSGLIEPSGEPPGTPYFS   1821 - 1890
GDFASTTNVSGESSVAMGTSGEASGLPEVTLITSEFVEGVTEPTISQELGQRPPVTHTPQLFESSGKVST   1891 - 1960
AGDISGATPVLPGSGVEVSSVPESSSETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEANLERSS   1961 - 2030
GLGVSGSTLTFQEGEASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVIST   2031 - 2100
SIPESEWTQQTQRPAETHLEIESSSLLYSGEETHTVETATSPTDASIPASPEWKRESESTAAAPARSCAE   2101 - 2170
EPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHFPDRETWVDAERRCREQQSHL   2171 - 2240
SSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKG   2241 - 2310
EWNDVPCNYHLPFTCKKGTVACGEPPVVEHARTFGQKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGH   2311 - 2380
WEEPRITCTDATTYKRRLQKRSSRHPRRSRPSTAH                                      2381 - 2415
//

Text Mined References (120)

PMID Year Title
26943656 2016 Characterization and Localization of Citrullinated Proteoglycan Aggrecan in Human Articular Cartilage.
25741789 2015 Idiopathic short stature due to novel heterozygous mutation of the aggrecan gene.
25715982 2015 Identification of homozygous deletion in ACAN and other candidate variants in familial classical Hodgkin lymphoma by exome sequencing.
25603412 2015 Aggrecan and chondroitin-6-sulfate abnormalities in schizophrenia and bipolar disorder: a postmortem study on the amygdala.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
25188217 The interaction between aggrecan gene VNTR polymorphism and obesity in predicting incident symptomatic lumbar disc herniation.
25173489 2014 The BGN and ACAN genes and carpal tunnel syndrome.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24766640 2014 Evaluation of MYOC, ACAN, HGF, and MET as candidate genes for high myopia in a Han Chinese population.
24762113 2014 Short stature, accelerated bone maturation, and early growth cessation due to heterozygous aggrecan mutations.
24552666 2014 Genes encoding proteoglycans are associated with the risk of anterior cruciate ligament ruptures.
24421874 2014 NPPB and ACAN, two novel SHOX2 transcription targets implicated in skeletal development.
24398992 2013 The involvement of growth differentiation factor 5 (GDF5) and aggrecan in the epithelial-mesenchymal transition of salivary gland pleomorphic adenoma.
24312401 2013 PKC? signalling activates ERK1/2, and regulates aggrecan, ADAMTS5, and miR377 gene expression in human nucleus pulposus cells.
24296484 2013 Aggrecan variable number of tandem repeat polymorphism and lumbar disc degeneration: a meta-analysis.
24111521 2014 ROCK inhibition enhances aggrecan deposition and suppresses matrix metalloproteinase-3 production in human articular chondrocytes.
24063364 2014 microRNA-140 targets RALA and regulates chondrogenic differentiation of human mesenchymal stem cells by translational enhancement of SOX9 and ACAN.
24032649 2014 Antigen-specific B lymphocytes acquire proteoglycan aggrecan from cartilage extracellular matrix resulting in antigen presentation and CD4+ T-cell activation.
23897278 2013 ADAMTS-4_v1 is a splice variant of ADAMTS-4 that is expressed as a protein in human synovium and cleaves aggrecan at the interglobular domain.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23370687 2013 ISSLS Prize winner: Effect of link protein peptide on human intervertebral disc cells.
23237500 2013 Incomplete elongation of the chondroitin sulfate linkage region on aggrecan and response to interleukin-1?.
23209686 2012 Vitamin D receptor gene and aggrecan gene polymorphisms and the risk of intervertebral disc degeneration - a meta-analysis.
22820679 2012 Multiple enhancers associated with ACAN suggest highly redundant transcriptional regulation in cartilage.
22670872 2012 MMP proteolysis of the human extracellular matrix protein aggrecan is mainly a process of normal turnover.
22441960 2013 Changes in synovial fluid biochemical markers following arthroscopic surgery in patients with knee osteoarthritis.
22329809 2012 Regional variation in human supraspinatus tendon proteoglycans: decorin, biglycan, and aggrecan.
22297263 2012 Aggrecan: Beyond cartilage and into the brain.
22241609 2012 Chondrogenic differentiation of induced pluripotent stem cells from osteoarthritic chondrocytes in alginate matrix.
22015197 2011 [Effects of Chinese herbal medicine Yiqi Huayu Bushen Recipe on expressions of aggrecan and type X collagen mRNAs in cells from degenerated human intervertebral discs].
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21948754 2011 Short aggrecan gene repetitive alleles associated with lumbar degenerative disc disease in Turkish patients.
21689646 2011 Variations in aggrecan localization and gene expression patterns characterize increasing stages of human intervertebral disk degeneration.
21655647 2011 Alterations in expression of cartilage-specific genes for aggrecan and collagen type II in osteoarthritis.
21277254 2011 Quantitative correlation between production rate of melanoma inhibitory activity and aggrecan gene expression level during differentiation from mesenchymal stem cells to chondrocytes and redifferentiation of chondrocytes.
21224775 2011 Outcome of lumbar epidural steroid injection is predicted by assay of a complex of fibronectin and aggrecan from epidural lavage.
21117903 2011 Human growth plate contains aggrecan fragments that can be generated by m-calpain.
21039430 2010 Variable number of tandem repeat polymorphisms (VNTRs) in the ACAN gene associated with pectus excavatum.
20936487 2011 The association of aggrecan gene polymorphism with the risk of intervertebral disc degeneration.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20806220 2010 Order within disorder: aggrecan chondroitin sulphate-attachment region provides new structural insights into protein sequences classified as disordered.
20640910 2010 Circulating levels of interleukin-6, vascular endothelial growth factor, YKL-40, matrix metalloproteinase-3, and total aggrecan in spondyloarthritis patients during 3 years of treatment with TNF? inhibitors.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618160 2010 Calpain is involved in C-terminal truncation of human aggrecan.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20505571 2010 Association between the expression of aggrecan and the distribution of aggrecan gene variable number of tandem repeats with symptomatic lumbar disc herniation in Chinese Han of Northern China.
20496110 2010 Lumbar disk degeneration disease and aggrecan gene polymorphism in northern Iran.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20367178 2010 Association of the polymorphisms of vitamin D receptor and aggrecan genes with degenerative disc disease.
20367118 2010 The interaction between aggrecan gene VNTR polymorphism and cigarette smoking in predicting incident symptomatic intervertebral disc degeneration.
20137779 2010 A missense mutation in the aggrecan C-type lectin domain disrupts extracellular matrix interactions and causes dominant familial osteochondritis dissecans.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19790048 2009 Hypoxia-inducible factor 1alpha inhibits the fibroblast-like markers type I and type III collagen during hypoxia-induced chondrocyte redifferentiation: hypoxia not only induces type II collagen and aggrecan, but it also inhibits type I and type III collagen in the hypoxia-inducible factor 1alpha-dependent redifferentiation of chondrocytes.
19669783 2009 Topographical variation in the distributions of versican, aggrecan and perlecan in the foetal human spine reflects their diverse functional roles in spinal development.
19657146 2009 Identification of a novel HtrA1-susceptible cleavage site in human aggrecan: evidence for the involvement of HtrA1 in aggrecan proteolysis in vivo.
19545413 2009 Synovial fluid level of aggrecan ARGS fragments is a more sensitive marker of joint disease than glycosaminoglycan or aggrecan levels: a cross-sectional study.
19333097 2009 Mechanical stimulation alters pleiotrophin and aggrecan expression by human intervertebral disc cells and influences their capacity to stimulate endothelial migration.
19298220 2009 N-terminal domains of CCN family 2/connective tissue growth factor bind to aggrecan.
19294492 2009 Ultrastructural immunolocalization of a cartilage-specific proteoglycan, aggrecan, in salivary pleomorphic adenomas.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19220578 2009 Differential distribution of aggrecan isoforms in perineuronal nets of the human cerebral cortex.
19180518 2009 Associations of 25 structural, degradative, and inflammatory candidate genes with lumbar disc desiccation, bulging, and height narrowing.
19110214 2009 A recessive skeletal dysplasia, SEMD aggrecan type, results from a missense mutation affecting the C-type lectin domain of aggrecan.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
19004047 2008 Association between the aggrecan gene and rheumatoid arthritis.
18829133 2010 Perineuronal nets are largely unaffected in Alzheimer model Tg2576 mice.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
18055126 2008 Aggrecan-based extracellular matrix is an integral part of the human basal ganglia circuit.
18040638 2007 Osteogenic protein-1 with transforming growth factor-beta1: potent inducer of chondrogenesis of synovial mesenchymal stem cells in vitro.
17632389 2007 Association between the aggrecan gene variable number of tandem repeats polymorphism and intervertebral disc degeneration.
17588949 2007 Interaction of cartilage oligomeric matrix protein/thrombospondin 5 with aggrecan.
17568421 2007 Influence of extracellular osmolarity and mechanical stimulation on gene expression of intervertebral disc cells.
17261541 2007 G1-G2 aggrecan product that can be generated by M-calpain on truncation at Ala709-Ala710 is present abundantly in human articular cartilage.
16741449 2006 Lack of association between the aggrecan gene and familial idiopathic scoliosis.
16650460 2006 Aggrecan expression is substantially and abnormally upregulated in Hutchinson-Gilford Progeria Syndrome dermal fibroblasts.
16574327 2006 Cartilage aggrecan undergoes significant compositional and structural alterations during laryngeal cancer.
16537531 2006 Aggrecan turnover in human intervertebral disc as determined by the racemization of aspartic acid.
16425147 2006 The involvement of aggrecan polymorphism in degeneration of human intervertebral disc and articular cartilage.
16402214 2006 Genetic variability in the extracellular matrix protein as a determinant of risk for developing HTLV-I-associated neurological disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16080123 2005 A mutation in the variable repeat region of the aggrecan gene (AGC1) causes a form of spondyloepiphyseal dysplasia associated with severe, premature osteoarthritis.
16001263 2005 Quantitation of collagen I, collagen II and aggrecan mRNA and expression of the corresponding proteins in human nucleus pulposus cells in monolayer cultures.
15590670 2005 Expression and purification of functionally active hyaluronan-binding domains from human cartilage link protein, aggrecan and versican: formation of ternary complexes with defined hyaluronan oligosaccharides.
14724283 2004 Link protein has greater affinity for versican than aggrecan.
14722076 2004 Alternative splicing in the aggrecan G3 domain influences binding interactions with tenascin-C and other extracellular matrix proteins.
14627072 2003 Clinical correlations of aggrecan in the resected medial rectus muscle of patients with intermittent exotropia.
14558103 2003 Induction of arthritis in SCID mice by T cells specific for the "shared epitope" sequence in the G3 domain of human cartilage proteoglycan.
12888576 2003 Distinct interaction of versican/PG-M with hyaluronan and link protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12205105 2002 Identification of a locus for a form of spondyloepiphyseal dysplasia on chromosome 15q26.1: exclusion of aggrecan as a candidate gene.
12054629 2002 ADAMTS1 cleaves aggrecan at multiple sites and is differentially inhibited by metalloproteinase inhibitors.
11932252 2002 Cleavage of the carboxyl tail from the G3 domain of aggrecan but not versican and identification of the amino acids involved in the degradation.
11854269 2002 ADAMTS4 cleaves at the aggrecanase site (Glu373-Ala374) and secondarily at the matrix metalloproteinase site (Asn341-Phe342) in the aggrecan interglobular domain.
11038354 2001 The proteoglycans aggrecan and Versican form networks with fibulin-2 through their lectin domain binding.
10922468 2000 Matrix metalloproteinases 19 and 20 cleave aggrecan and cartilage oligomeric matrix protein (COMP).
10400671 1999 Fibulin-1 is a ligand for the C-type lectin domains of aggrecan and versican.
9756610 1998 Roles of aggrecan, a large chondroitin sulfate proteoglycan, in cartilage structure and function.
9688535 1998 Membrane-type 1 MMP (MMP-14) cleaves at three sites in the aggrecan interglobular domain.
9654129 1998 TSG-6 interacts with hyaluronan and aggrecan in a pH-dependent manner via a common functional element: implications for its regulation in inflamed cartilage.
9013976 1997 Secreted chondroitin sulfate proteoglycan of human B cell lines binds to the complement protein C1q and inhibits complex formation of C1.
8921002 1996 Species-specific alternative splicing of the epidermal growth factor-like domain 1 of cartilage aggrecan.
8611178 1996 Age-related changes in the content of the C-terminal region of aggrecan in human articular cartilage.
8349621 1993 Expression of alternatively spliced epidermal growth factor-like domains in aggrecans of different species. Evidence for a novel module.
8314595 1993 Assignment of the human aggrecan gene (AGC1) to 15q26 using fluorescence in situ hybridization analysis.
8216415 1993 The structure of aggrecan fragments in human synovial fluid. Evidence that aggrecanase mediates cartilage degradation in inflammatory joint disease, joint injury, and osteoarthritis.
8216228 1993 Fibroblast and neutrophil collagenases cleave at two sites in the cartilage aggrecan interglobular domain.
7998967 1994 Neutrophil collagenase (MMP-8) cleaves at the aggrecanase site E373-A374 in the interglobular domain of cartilage aggrecan.
7827755 1994 Length variation in the keratan sulfate domain of mammalian aggrecan.
7626017 1995 Structure of the human aggrecan gene: exon-intron organization and association with the protein domains.
7574678 1995 Catabolism of aggrecan by explant cultures of human articular cartilage in the presence of retinoic acid.
7524681 1994 Analysis of aggrecan and tenascin gene expression in mouse skeletal tissues by northern and in situ hybridization using species specific cDNA probes.
7240256 1981 Absence of proteoglycan core protein in cartilage from the cmd/cmd (cartilage matrix deficiency) mouse.
2789216 1989 A new epidermal growth factor-like domain in the human core protein for the large cartilage-specific proteoglycan. Evidence for alternative splicing of the domain.
1985970 1991 Complete coding sequence and deduced primary structure of the human cartilage large aggregating proteoglycan, aggrecan. Human-specific repeats, and additional alternatively spliced forms.
1569188 1992 The structure of aggrecan fragments in human synovial fluid. Evidence for the involvement in osteoarthritis of a novel proteinase which cleaves the Glu 373-Ala 374 bond of the interglobular domain.
1326552 1992 The interglobular domain of cartilage aggrecan is cleaved by PUMP, gelatinases, and cathepsin B.