Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.98
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.700 2.8e-03
ependymoma -2.500 1.1e-02
oligodendroglioma -2.700 4.3e-03
osteosarcoma -1.674 4.1e-03
cystic fibrosis 1.037 5.2e-04
medulloblastoma, large-cell -1.200 4.3e-02
juvenile dermatomyositis 1.437 1.3e-08
adrenocortical carcinoma 1.754 2.7e-03
pancreatic ductal adenocarcinoma liver m... -1.886 9.1e-03
intraductal papillary-mucinous adenoma (... 1.500 3.6e-02
intraductal papillary-mucinous carcinoma... 1.600 3.6e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.0e-02
pancreatic cancer 1.200 7.8e-03
Breast cancer 3.200 2.6e-02
Pneumonia -1.100 1.2e-02
lung carcinoma -2.000 3.6e-22
breast carcinoma 1.200 4.4e-16
gastric carcinoma 1.100 3.0e-02
ductal carcinoma in situ 2.000 4.5e-04
invasive ductal carcinoma 1.700 1.3e-02
ovarian cancer 2.900 5.6e-05
pituitary cancer -1.200 3.7e-02

Gene RIF (1)

PMID Text
21082705 Solution structure of the human HSPC280 protein

AA Sequence

MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGV      1 - 70
HDDVDIILLQD                                                                71 - 81
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21082705 2011 Solution structure of the human HSPC280 protein.
20940261 2010 Costars, a Dictyostelium protein similar to the C-terminal domain of STARS, regulates the actin cytoskeleton and motility.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15723814 2005 A proteomic analysis of human hemodialysis fluid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.